DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G62150

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_176406.1 Gene:AT1G62150 / 842511 AraportID:AT1G62150 Length:463 Species:Arabidopsis thaliana


Alignment Length:391 Identity:82/391 - (20%)
Similarity:141/391 - (36%) Gaps:105/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILRNSQNAAKN--ATITS---QIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPAEC----EGS 64
            :|..|:.|:.:  ..|.|   :|..::|.:|:....:::..  |.......|.|.. |    |||
plant   131 LLMQSRGASSSELTEIVSKVPKILGMKGDKSIGRYYDIVKE--IIEADKSSKFEKL-CHSLPEGS 192

  Fly    65 KEVALDFRN----REAHVPS---FNLAAYVNN---------SSTLQQFLSLGVD------LHSIE 107
            |: ....||    |:..||.   |:| .:.|:         ..:|.:.:.:|.|      :.::.
plant   193 KQ-ENKIRNVLVLRDLGVPQRLLFSL-LFSNHHVCCGKEKFEESLNKVVGMGFDPTTPKFVEALC 255

  Fly   108 RRKGLGDFVLKLDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRF 172
            ...||.|..|    |:|...|..|    |::.:|...:|.|.|.......:.:......||....
plant   256 IVYGLSDKRL----EENFNVYKRF----GLTVNDVWELFKKCPAFLGYSENRIIQTFEALKRCGL 312

  Fly   173 SDEARQRILTQNPYWLMFSTRRVDRR------LGYFQKEFKLSGHDLRLLATREPNAITYNMEHL 231
            .::....:..:||..|..|.:::...      ||:.:.||.:....|       |..|.|:.|.:
plant   313 CEDEVLSVFKKNPLCLRASEQQILNSMETFIGLGFSRDEFVMMVKCL-------PQCIGYSAEMV 370

  Fly   232 RKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLA-SR 295
            :|.               ::.||:|                     |..|...|...|::|. |.
plant   371 KKK---------------TEFVVKK---------------------MNWPLKVITLFPQVLGYSM 399

  Fly   296 EFRLRERHEFLK------LLGRAQYDPQKD-LYISPKTIVEGNNFYFVRNVAKSDLETFDLFLKT 353
            |.|...|...:|      ||| ::..|... |..:.:|.::.   |.|.:..|..||...:|.:.
plant   400 EKRTVPRCNVIKALMSKGLLG-SELPPMASVLACTDQTFLKR---YVVEHDEKLVLELMSIFNQD 460

  Fly   354 R 354
            |
plant   461 R 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 37/191 (19%)
AT1G62150NP_176406.1 mTERF 94..438 CDD:367120 75/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.