DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G62110

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_176402.2 Gene:AT1G62110 / 842507 AraportID:AT1G62110 Length:462 Species:Arabidopsis thaliana


Alignment Length:376 Identity:77/376 - (20%)
Similarity:146/376 - (38%) Gaps:67/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NAAKNATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKK--------TEPAECEGSKEV---- 67
            :|.|:..|..|....||..|......|.|.|.|...:..|.        .|..|.:.|.:.    
plant   115 DAEKSLDIKLQFLESRGASSPELTQIVSTVPKILGMKEGKSLGRYYDFVKEIIEADKSSKYETLC 179

  Fly    68 -ALDFRNREAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVL--------KLDFEK 123
             .|...||:.:        .:.|.|.|:   .|||.      :|.|...::        |.:||:
plant   180 QPLPEANRQGN--------KIRNVSVLR---DLGVP------QKLLFSLLISDAQPVCGKENFEE 227

  Fly   124 NVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWL 188
            ::|.    :|:.|..|.. .:.......:::.....::.|||..|...|:.|....:..:.||:|
plant   228 SLKK----VVEMGFDPTT-SKFVQALRAVYRFTDKTIEERVNVYKGFGFAVEDVWAMFKKCPYFL 287

  Fly   189 MFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLV 253
            ..|.:::.:.:...:|...|....:.:| .:.|..|..:.:.:..|: .:...:||:..|...:|
plant   288 NSSEKKIGQTIETLKKCGLLEDEVISVL-KKYPQCIGTSEQKILNSI-EIFLGLGFSRDEFITMV 350

  Fly   254 VRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRERH-------EFL---KL 308
            .|.|:.|::..:.:.::..::.:.|..|...:|..|.:|.   :.|.:|.       |.|   :|
plant   351 KRFPQCLILSAETVKKKIEFVVKKMNWPLKDVVSNPTVLG---YNLEKRTVPRCNVIEALMSKRL 412

  Fly   309 LGRAQYDPQKDLYISPKTIVEGNNFY---FVRNVAKSD--LETFDLFLKTR 354
            ||    |...:|......:|..:..:   :|||....:  ||...::.:.|
plant   413 LG----DTGSELPPMSSVLVCTDELFLKRYVRNHGDKELVLELMTIYTRGR 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 37/194 (19%)
AT1G62110NP_176402.2 mTERF 88..435 CDD:280667 71/350 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.