DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G61990

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001322437.1 Gene:AT1G61990 / 842494 AraportID:AT1G61990 Length:414 Species:Arabidopsis thaliana


Alignment Length:305 Identity:64/305 - (20%)
Similarity:106/305 - (34%) Gaps:110/305 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QIRNLRGQQSVHHEVEVLTSPGITTKQN--------------DKKTE---PAECEGSKEVALDFR 72
            ||...||..|......|.|.|.|..|::              |..:.   |...:|:|     .|
plant   125 QILQSRGASSSEITEIVSTVPRILGKKSITVYYDAVKDIIVADTSSSYELPQGSQGNK-----IR 184

  Fly    73 N----REAHVPSFNLAAYV-----------NNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDF- 121
            |    ||..:||..|...:           |..::|::.:.:|.|..:.:       |||.|.. 
plant   185 NVSALRELGMPSRLLLPLLVSKSQPVCGKENFDASLKKVVEMGFDPTTTK-------FVLALRML 242

  Fly   122 ----EKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKS-KRFSDEARQRIL 181
                ||.::..:......|.:.||...:|.|.|.:.|      .::...||| :.|.|       
plant   243 YQMSEKTIEEKVVVFRSLGFTVDDVWEIFKKTPSVLK------VSKKKILKSAETFLD------- 294

  Fly   182 TQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNA 246
                             |||.:.||       .::..|.|..|.|::|.::|.            
plant   295 -----------------LGYSRAEF-------LMMVKRYPPCIEYSVESVKKK------------ 323

  Fly   247 KELSDLVVRK---PR-LLMIPPDDLVERFSYIHQDMGLPHAQIVQ 287
               ::.:|:|   || .|::.|    :.|.|..:...:|...|::
plant   324 ---NEFLVKKMKWPRNALVLHP----QVFGYSMEKRIIPRCNILE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 35/171 (20%)
AT1G61990NP_001322437.1 mTERF 88..390 CDD:367120 64/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.