DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G61980

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001319290.1 Gene:AT1G61980 / 842493 AraportID:AT1G61980 Length:418 Species:Arabidopsis thaliana


Alignment Length:304 Identity:65/304 - (21%)
Similarity:113/304 - (37%) Gaps:75/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NAAKNATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPAECEGSKEVALDFRNREAH-- 77
            :|.|:.....|....||..|......|.|.|.|..|:. .||.....:..||..||..::...  
plant   115 DAEKSLAPKLQFLQSRGASSSELTEIVSTVPKILGKRG-HKTISVFYDFIKETLLDKSSKSEKSC 178

  Fly    78 --VPSFNLAAYVNNSSTLQQF---------LSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITF 131
              .|..||...:.|.|.|::.         |.:..|:....:.|          ||:::|.    
plant   179 QPFPQGNLENKIRNLSVLRELGMPHKLLFPLLISCDVPVFGKEK----------FEESLKK---- 229

  Fly   132 LVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVD 196
            :|:.|..|         :...|.|.|..:|.    |..|...|:.       |.|          
plant   230 VVEMGFDP---------STSKFVEALCVVQR----LSDKNIEDKV-------NAY---------- 264

  Fly   197 RRLGYFQKEFKLSGHDLRLLAT---REPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPR 258
            :|||:          |:..:.|   |.||.:|::.:.:..::.|.. .:||:..|.|.|:.|.|:
plant   265 KRLGF----------DVEYVWTVFKRWPNFLTHSEKKILNTIETFL-GLGFSRDEFSVLIKRFPQ 318

  Fly   259 LLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRER 302
            .:.:..:.:.::..::.:.|..|...:|..|.:|.   :.|.:|
plant   319 GIGLSAEMVKKKTEFLVKKMNWPLKALVSNPAVLG---YSLEKR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 38/184 (21%)
AT1G61980NP_001319290.1 mTERF 88..395 CDD:367120 65/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.