DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G61970

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001185290.1 Gene:AT1G61970 / 842492 AraportID:AT1G61970 Length:418 Species:Arabidopsis thaliana


Alignment Length:369 Identity:66/369 - (17%)
Similarity:131/369 - (35%) Gaps:101/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NSQNAAKNATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPAECEGSKEVALDFRNREA 76
            |..::|..|.::.::.......:|.:.|:.|   |:|||..:..        |::|:.:.:|   
plant    32 NFFSSASAACLSPRVGRKGNNFTVSYLVDSL---GLTTKLAESI--------SRKVSFEDKN--- 82

  Fly    77 HVPSFNLAAYVNNSSTLQQFLS---LGVDLHSIERRKGLGDF--VLKLDFEKNVKPYITFLVDQG 136
                       |..|.|....|   .|..:.:|.|     |:  :|..|.||::.|.:.||..:|
plant    83 -----------NPDSVLNLLTSHGFTGSQISTIIR-----DYPQLLIADAEKSLGPKLQFLQSRG 131

  Fly   137 VSPDDFGRMFTKNP-LLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQN---------------- 184
            .|..:...:.:..| :|.|:....:....:::|.......::...|..:                
plant   132 ASSSEITEIVSSVPEILGKKGHKTISVYYDFIKDTLLEKSSKNEKLCHSLPQGNLENKIRNVSVL 196

  Fly   185 -----PYWLMFSTRRVDRRLGYFQKEFKLS-------GHDLRLLATREPNAITYNME-------- 229
                 |:.|:||....|.:....:::|:.:       |.|.......|...:.|.|.        
plant   197 RELGMPHKLLFSLLISDSQPVCGKEKFEETLKKVVEMGFDPTTSKFVEALQVIYKMNEKTIEEKV 261

  Fly   230 HLRKSV-----------------FTLKEE-----------MGFNAKELSDLVVRKPRLLMIPPDD 266
            ||.||:                 ..:.|:           :||:..|.:.:|...|..:.:..:.
plant   262 HLYKSLGFDVGDVWSSFKKWPISLRVSEKKMLDSIETFLGLGFSRDEFAKMVKHFPPCIGLSTET 326

  Fly   267 LVERFSYIHQDMGLPHAQIVQCPELLA-SREFRLRERHEFLKLL 309
            :.::..::.:.|..|...:|..|.:.. |.|.|:..|...:|.|
plant   327 VKKKTEFLVKKMNWPLKAVVSNPAVFGYSLEKRIVPRGNVIKAL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 41/250 (16%)
AT1G61970NP_001185290.1 mTERF 88..395 CDD:367120 51/288 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.