DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G61960

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_176387.1 Gene:AT1G61960 / 842491 AraportID:AT1G61960 Length:457 Species:Arabidopsis thaliana


Alignment Length:407 Identity:78/407 - (19%)
Similarity:137/407 - (33%) Gaps:137/407 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRNSQNAAKNATITSQIRNLRGQQ-SVHHEVEVLTSPGITTKQNDKKTEPAECEGSKEVALDFRN 73
            |.||.:.|..|..| .|.:|:|.. :|.:.|:.|   |:|||..:..        ||:|:.:.|.
plant    30 LSNSFSFASVADAT-LIDSLKGNNFTVSYLVDSL---GLTTKLAESI--------SKKVSFEERR 82

  Fly    74 REAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVS 138
            ....|.|. |.:|....|.:...:::...|             |.||.||::.|.:..|..:|.|
plant    83 NPDSVLSL-LTSYGFTKSQISSIITIYPRL-------------LALDAEKSIAPKLQSLQSRGAS 133

  Fly   139 PDDFGRM---------------------FTKN--------------------------------- 149
            ..:..::                     |.|:                                 
plant   134 SSELTQIVSTVPKILGKRGHKSITVYYDFVKDIIEADKSSSYEKLCHSFPQGNKKNKIRNISVLR 198

  Fly   150 ----------PLL------------FKEDL---------------------------DDLQTRVN 165
                      |||            |:|.|                           ..::.:||
plant   199 ELGVAQRLLFPLLISDGQPVCGKERFEESLKKVVEMGFDPETTKFVEALRVIYRMSDKTIEEKVN 263

  Fly   166 YLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQ--KEFKLSGHDLRLLATREPNAITYNM 228
            ..|...|.......|..:.|.:|.:|.:::...   |:  |...|..|::.||..:.|..|..:.
plant   264 VYKRLGFGVADVWAIFKKWPSFLSYSEKKITHT---FETLKSCGLLKHEVLLLLKKHPKCICSSE 325

  Fly   229 EHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLA 293
            :.:..|:.|.. .:||:..|.:.:|.|.|:.:....:.:.::..:|.::|..|...:|..|::..
plant   326 QKIVNSIETFL-GLGFSRDEFAMMVKRYPQCIDYTAETVKKKTEFIVKNMNWPLEALVSIPQVFG 389

  Fly   294 -SREFRLRERHEFLKLL 309
             |.|.|...|...:|.|
plant   390 YSLEKRTVPRCNVIKTL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 47/290 (16%)
AT1G61960NP_176387.1 mTERF 88..433 CDD:367120 57/337 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.