DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G56380

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001154432.1 Gene:AT1G56380 / 842091 AraportID:AT1G56380 Length:399 Species:Arabidopsis thaliana


Alignment Length:284 Identity:63/284 - (22%)
Similarity:109/284 - (38%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RRKGLGDFVLKLDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRF 172
            :|....|.|:..|.:|..|..:::|||....|..|.....|.  :..:|..:..:.:|.|:|..|
plant     9 KRSTDADDVIPRDAQKEPKLTVSYLVDSVGIPIKFAESILKE--VSSKDKCNPNSVLNLLRSYDF 71

  Fly   173 SDEARQRILTQNPYWLMFSTRR-VDRRLGYFQKEFKLSGHDLRLLATREP---------NAITY- 226
            :|.....|:|.:|..||..... :..:|.:.:....||.. |..:.||.|         :.||| 
plant    72 TDSQISSIITTDPELLMEDAENSLCPKLKFLESREILSSR-LNDIVTRVPKILRMEEEKSMITYY 135

  Fly   227 ------NMEHLRKSVFTLKE-------------EMGFN--AKELSDLVVRKPRLLMIPPDDLVER 270
                  .:...|...:.:.|             ||||:  |.::.|..|   .:..:..:.|.||
plant   136 DFVKTITLTSSRSDFYKVCELYPYIESSIRKVIEMGFDPFAPKIFDATV---VVCTLSNETLEER 197

  Fly   271 FSYIHQDMGLPHAQI----VQCPELLASREFRLRERHEFLKLLGRAQYDPQKDLYISPKTIVEG- 330
            .: |::.:|.....:    .:||..|...|.::.:..|.||..|..:.:.......||:.|... 
plant   198 VN-IYKTLGFDVRDVWEMFKKCPTFLNISEKKITQSFETLKKCGLVEEEVISMFQKSPQCIDFSE 261

  Fly   331 ----NNFYFVRNVAKSDLETFDLF 350
                .||.|::.....:.|...:|
plant   262 LDITQNFEFLKGCGLVEEEVLSMF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 48/220 (22%)
AT1G56380NP_001154432.1 mTERF 63..375 CDD:303004 50/228 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.