DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G21150

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001322646.1 Gene:AT1G21150 / 838711 AraportID:AT1G21150 Length:454 Species:Arabidopsis thaliana


Alignment Length:398 Identity:72/398 - (18%)
Similarity:146/398 - (36%) Gaps:85/398 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRNSQNAAKNATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPA-----------EC-- 61
            |.:.:|....|..:|.:|.:.....:...:..|.|......:|.:|.:|.           .|  
plant    68 LLHCRNVVDCAFTSSTVRRIVNLGFLVGRIRTLCSVSQVKSENLEKQKPCLESFTVSYLVDSCGL 132

  Fly    62 --EGSKEVALDFRNREAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKN 124
              |.:|..:...:...:..|...||.:.::..|..|..|:   :.|..|       ||.|..|..
plant   133 SLESAKSNSRFVKLVSSKKPDSVLALFKDHGFTNDQITSV---IKSFPR-------VLSLSPEDV 187

  Fly   125 VKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDL--------DDLQT------------------- 162
            :.|.:.|....|.|..|..:|.:.:|.:....|        |.|::                   
plant   188 ISPKLMFFSSIGFSTSDTAKMISSSPKMLSYSLHKRLIPCYDSLKSILVEEESVVKCLKRGIRCF 252

  Fly   163 --RVNYLKSKRFS--------DEARQRILTQNPYWLMFSTRR---VDRRLGYFQKEFKLSGHDLR 214
              ::.:..|.|.|        |::.:.::..:|:......||   |..|:..:..:.|.:|....
plant   253 SLKITHCVSLRVSICRELGVPDKSIKWLVQASPFTFFSRERRFNEVLNRVCSYGFDPKKAGFVHA 317

  Fly   215 LLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMG 279
            ::      |.....|...:..|.|.:..|::.::....::|.|..:.:..:.::....|:..::|
plant   318 MV------AFDCTSESAMERKFKLFQCFGWSKEDFVAAIMRFPNCVTVSDEKIMYTLEYLVNNIG 376

  Fly   280 LPHAQIVQCPELLA-SREFRLRERHEFLKLLGRAQYDPQKDLYISPKTIVEGNNFYFVRNVAKSD 343
            |....||..|.:|: |.|.|::.|::.:.||.......::|:           |::.:..:..| 
plant   377 LQARDIVARPVVLSLSMEKRIKPRNQVISLLLSKGLVKKEDI-----------NYFTILKLKSS- 429

  Fly   344 LETFDLFL 351
             |..|.|:
plant   430 -EFMDKFV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 40/225 (18%)
AT1G21150NP_001322646.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.