DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT5G64950

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_201300.1 Gene:AT5G64950 / 836619 AraportID:AT5G64950 Length:391 Species:Arabidopsis thaliana


Alignment Length:269 Identity:59/269 - (21%)
Similarity:99/269 - (36%) Gaps:45/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVSPDDFGRMF 146
            ||.:.....|.:|...|.......|::...:...::..:.||.::|.:.|..|.|.:....|:..
plant    64 NLKSLEQPRSVIQMLKSYSFSDTQIQKSIRVHPRMMFYNVEKILEPKLRFFKDIGFTGSGLGKFV 128

  Fly   147 TKNPLLFKEDL-DDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRL------GYFQK 204
            ::|..:....| ..|...|..|||..........::.....||:.|.   |..|      .|.: 
plant   129 SQNSSVVGVSLVKKLIPTVEILKSIVAPKHEDLPVILSRCGWLLLSR---DPNLFLLPNISYLE- 189

  Fly   205 EFKLSGHDLRLLATREPNAITYNMEHLRKSV-------FTLKEEM-------------------- 242
            ...:.|..|..|..|:|.....:.|.||..|       |||...|                    
plant   190 TCGIVGSQLASLLRRQPRIFNLSEEKLRGYVSRALDLGFTLNSRMLVHAVISLSSLSEKTFDRKV 254

  Fly   243 ------GFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLA-SREFRLR 300
                  ||:..|::|::.|.|.|:....|.|...|.:..:.|||....:.:.|.:|: :.|.|:.
plant   255 KLFMANGFSEDEITDIIRRSPGLIRCSEDKLTLGFEFYLKRMGLEREALAKRPCVLSYNLEKRVI 319

  Fly   301 ERHEFLKLL 309
            .|.:.|::|
plant   320 PRLKVLQIL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 51/225 (23%)
AT5G64950NP_201300.1 mTERF 42..326 CDD:303004 57/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.