DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT5G06810

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_196299.2 Gene:AT5G06810 / 830572 AraportID:AT5G06810 Length:588 Species:Arabidopsis thaliana


Alignment Length:334 Identity:74/334 - (22%)
Similarity:118/334 - (35%) Gaps:87/334 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 STLQQFLSLGVDLHSI----ERRKGLGDFVLKLDFEKNVK---PYITFLVDQGVSPDDFGRMFTK 148
            |::.:.|||   |..|    |:..||......|.||.:.|   ..:.|....|.|..:...:|.|
plant   270 SSVHRVLSL---LREICFDEEKLYGLIRNCPSLLFENSGKWTGILVGFETKLGASRSELCSLFQK 331

  Fly   149 NPLLFKED-LDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHD 212
            .||:..|. :.:|:....:||.....|:...::...:.:||.....:....|..|.|..|     
plant   332 FPLIQVEKCVSNLRQCFLFLKEIEMEDDEIHKVFRSHSWWLGSCKLKKTSSLLVFLKAGK----- 391

  Fly   213 LRLLATREPNAITYNMEHLR-----------------------KSVFTL-------KEEM----- 242
                 ||....|..|.|.::                       |:.|.|       .|||     
plant   392 -----TRVCQVIQENPEEMKKWTMGSKIQPLPATNVDIESKSMKTQFLLDLGYKENSEEMETAMK 451

  Fly   243 -------------------GFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQC 288
                               ||..|::.|:|...|.:|....|.|..:.:|:.:::|.|.:.:|..
plant   452 NFRGKGSELRERFNVLVSLGFTKKDVKDMVKACPTMLSQTCDILESKVNYLIKELGYPLSTLVDF 516

  Fly   289 PELLASREFRLRERHE-FLKLLGRAQYDPQ----KDLYISPKTIVEGNNFYFVRNVAKS----DL 344
            |..|.....|::.|.. |..|..|.:.|.:    ..|..|.|..|   :|:..|:...|    ||
plant   517 PSCLKFTLQRMKLRFAMFSWLQARGKVDRKIKVSTMLACSDKIFV---SFFVNRHPDGSKHLEDL 578

  Fly   345 ETFDLFLKT 353
            :...|.::|
plant   579 KKLHLSVET 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 49/243 (20%)
AT5G06810NP_196299.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.