DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and pde191

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001190948.1 Gene:pde191 / 829972 AraportID:AT4G38160 Length:378 Species:Arabidopsis thaliana


Alignment Length:307 Identity:65/307 - (21%)
Similarity:119/307 - (38%) Gaps:66/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALRNILRNSQNAAK-NATITSQ----IRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEP-AECEG 63
            ::..:||..:...| .:.:.|:    :.|:.|.|.......|...|.|.|.:.|::..| .||..
plant    22 SIDKMLRKCKQLEKAQSDVASENWDYLSNIVGIQERKLPYIVSRCPKILTLRLDERLIPMVECLS 86

  Fly    64 S-----KEVALDFRNREAHVPSFNLAAYVNNSSTLQQF---LSLGVDLHSIERRKGLGDFVLKLD 120
            |     :|||                      |.:.:|   ||     ||:|.:           
plant    87 SLGRNPREVA----------------------SAITKFPPILS-----HSVEEK----------- 113

  Fly   121 FEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLD-DLQTRVNYLKSKRFSDEAR-QRILTQ 183
                :.|.:.|....||.....|:|...||.|....:| .|...|::|.|.....:.. .::|.:
plant   114 ----LCPLLAFFQALGVPETQLGKMILFNPRLISYSIDTKLTVIVSFLASLGLDQDGMIGKVLVK 174

  Fly   184 NPYWLMFSTRRVDRRL----GYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGF 244
            ||:.:.:|   ||:||    .:.:....||...::.:....|..:..::..:.|..:...:|.||
plant   175 NPFLMGYS---VDKRLRPTTEFLKSSVGLSEDGIKSVVMNFPQLLCRDVNKILKPNYDYLKECGF 236

  Fly   245 NAKELSDLVVRKPRLLM-IPPDDLVERFSYIHQDMGLPHAQIVQCPE 290
            ...:::.:|...|::|: ...:.|..|..::.|.||....::...||
plant   237 GDSQIATMVTGYPQILIKSVKNSLQPRIRFLVQVMGRGMDEVASYPE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 39/176 (22%)
pde191NP_001190948.1 mTERF 12..320 CDD:303004 65/307 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4421
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.