DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and BSM

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001329662.1 Gene:BSM / 828116 AraportID:AT4G02990 Length:541 Species:Arabidopsis thaliana


Alignment Length:321 Identity:64/321 - (19%)
Similarity:127/321 - (39%) Gaps:44/321 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CSALRNIL----RNSQNAAKNATITSQIRNLRGQQSVHHEVEVLTSP------GITTKQNDKKTE 57
            ||..:|::    ...:...:.:|.|..:|  |..|.:|..|.:..:|      |:..|.:|   .
plant   173 CSVKKNMVPVLDYLGKLGVRKSTFTEFLR--RYPQVLHSSVVIDLAPVVKYLQGLDIKPSD---V 232

  Fly    58 PAECEGSKEVALDFRNREAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDF------V 116
            |...|           |...|..|.|...:  |:::...:.:||      .|:.:|..      :
plant   233 PRVLE-----------RYPEVLGFKLEGTM--STSVAYLVGIGV------ARREIGGILTRYPEI 278

  Fly   117 LKLDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDD-LQTRVNYLKSKRFSDEARQRI 180
            |.:...:.:||.:.:|...|:......|:..|.|.:...:||| ::..|..|:.....:.:...|
plant   279 LGMRVARIIKPLVEYLEVLGIPRLAAARLIEKRPHILGFELDDTVKPNVQILQDFNVRETSLPSI 343

  Fly   181 LTQNPYWLMFSTR-RVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGF 244
            :.|.|..:....: ::|.:.........|:..||..|..|.|..::.:...:.|.:..| .:.||
plant   344 IAQYPEIIGIDLKPKLDTQRKLLCSAIHLNPEDLGSLIERMPQFVSLSESPMLKHIDFL-TKCGF 407

  Fly   245 NAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLA-SREFRLRERHE 304
            :..:..::|:..|::|.:....:...|.|..::|..|...:|..|.... ..|..::.||:
plant   408 SIDQTREMVIGCPQVLALNLGIMKLSFEYFQKEMKRPLQDLVDFPAFFTYGLESTVKPRHK 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 38/186 (20%)
BSMNP_001329662.1 PLN03196 60..512 CDD:215628 64/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4421
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.