DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT4G19650

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001328981.1 Gene:AT4G19650 / 827709 AraportID:AT4G19650 Length:592 Species:Arabidopsis thaliana


Alignment Length:217 Identity:45/217 - (20%)
Similarity:84/217 - (38%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRR 194
            |..:...|..|:..::..|.||.....:...:.|    |||..|:::| :.|.:..:.|      
plant   391 TACLSLNVKQDELCKILKKEPLRLFCFVSTTKKR----KSKPLSEDSR-KYLEKTEFLL------ 444

  Fly   195 VDRRLGYFQ---------KEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELS 250
               ||||.:         |:|:..|..|                   :..|....:.|.|...::
plant   445 ---RLGYVENSDEMVKALKQFRGRGDQL-------------------QERFDCLVKAGLNYNVVT 487

  Fly   251 DLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRERHEFLKLLGRAQYD 315
            :::...|.:|.:..|.:.::...:.:.:|.|...:|:.|..|.....|:  .|.|...|...:.|
plant   488 EIIRHAPMILNLSKDVIEKKIHSLTELLGYPIESLVRFPAYLCYDMQRI--HHRFSMYLWLRERD 550

  Fly   316 PQKDLYISPKTIVEGNNFYFVR 337
            ..|.: :||.||:...:..||:
plant   551 AAKPM-LSPSTILTCGDARFVK 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 36/185 (19%)
AT4G19650NP_001328981.1 mTERF 285..569 CDD:418649 43/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.