DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and MDA1

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001327961.1 Gene:MDA1 / 827109 AraportID:AT4G14605 Length:493 Species:Arabidopsis thaliana


Alignment Length:252 Identity:54/252 - (21%)
Similarity:106/252 - (42%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LSLGVDLHSIE----------------RRKGLGDFVLKLDFEK--------------------NV 125
            |.||::|..|:                :.|.:.:|:|.|...|                    |:
plant   204 LDLGLNLEQIKTITRKFAAFPYYSLDGKIKPVVEFLLDLGIPKSDIPTILCKRPQICGISLTDNL 268

  Fly   126 KPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMF 190
            ||.:.||...|:..:.:.::.::.|.:.......|.:.|.:|.....::|...||||:.|..:.:
plant   269 KPTMAFLETLGIDKNQWAKIISRFPAILTYSRQKLTSTVEFLSQTGLTEEQIGRILTRCPNIMSY 333

  Fly   191 STRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVR 255
            |   |:.:|....:.|:....|:.:|..|.|.....::|...|.|.....|.||...|:..::.|
plant   334 S---VEDKLRPTMEYFRSLNVDVAVLLHRCPQTFGLSIESNLKPVTEFFLEKGFGLDEIGIMISR 395

  Fly   256 KPRLLMIP-PDDLVERFSYIHQDMGLPHAQIVQCPELLA-SREFRLRERHEFLKLLG 310
            ...|.... .::::.::.|. |.|..|.:::|:.|:... |.:.|::.|:|.::..|
plant   396 YGALYTFSLKENVMPKWDYF-QTMDYPKSELVKFPQFFGYSLQERIKPRYELVQRSG 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 44/206 (21%)
MDA1NP_001327961.1 mTERF 211..468 CDD:418649 50/245 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.