DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and SHOT1

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_191599.1 Gene:SHOT1 / 825211 AraportID:AT3G60400 Length:558 Species:Arabidopsis thaliana


Alignment Length:289 Identity:61/289 - (21%)
Similarity:98/289 - (33%) Gaps:95/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KEVALDFRNREAHVPS---------FNLAAYVNNSSTLQQFLSLGVDLHS------IERRKGLGD 114
            ||..|.|..|...:.|         |:..|.:.....:.:.|..|.:|.|      ::.::...:
plant   150 KEERLVFVQRPGEIESRLLKFKDIGFSTVAVIGTCLAIPRTLCGGGELGSEIRCLFVKLKRLFDE 214

  Fly   115 FVLKLDFEKNVKPY------ITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFS 173
            |.....||:||..:      |....|.|...::...:..:|..||.|                :|
plant   215 FDSHHLFEENVDSWLAVSRKIRIFYDLGCENEEMWELMCRNKSLFLE----------------YS 263

  Fly   174 DEARQRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTL 238
            :||           ||       .:.|||.: |.:|..|..||..|.|..:.:::|....||..:
plant   264 EEA-----------LM-------NKAGYFCR-FGVSKEDAALLILRNPAIMNFDLEKPVISVTGM 309

  Fly   239 KEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRER- 302
            .:..|....|:               |.:.:::.|:     ....|:...|.:|  |...|.|| 
plant   310 LKHFGLRQDEV---------------DAVAQKYPYV-----FGRNQLKNLPYVL--RAIDLHERI 352

  Fly   303 --------HEFLKLLGRAQY---DPQKDL 320
                    |..|     |.|   ||.:||
plant   353 FDILKNGNHHLL-----ASYTLMDPDEDL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 40/199 (20%)
SHOT1NP_191599.1 mTERF <273..535 CDD:418649 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.