DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and EMB3114

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_850257.1 Gene:EMB3114 / 818173 AraportID:AT2G36000 Length:333 Species:Arabidopsis thaliana


Alignment Length:219 Identity:42/219 - (19%)
Similarity:94/219 - (42%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 EKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSK--RFSDEARQRILTQN 184
            |.::...:.:|...|:   ||..:..::|.|....|..:::.|:|:.:.  .|:.:..:|:::..
plant    70 ESSIHEKLIYLDSLGI---DFLTLINRHPPLLSTALSAVESVVDYMTTPPINFTLQDFRRLVSMC 131

  Fly   185 PYWLMFS-TRRVDRRLGYFQKEFKL-SGHDLRLLATREPNAITYNMEH-LRKSVFTLK------- 239
            |..|... |......:.:..:|..: |..|||....|.|..:..:::| ||.:::.|:       
plant   132 PELLTSPLTSHTIPVITFLLREVGVDSIFDLRQALRRRPRLLACSVDHQLRPTLYFLQRIGILDP 196

  Fly   240 ----------------------EEMGFNAKELSDLVVRKPRLLMIP-PDDLVERFSYIHQDMGLP 281
                                  |::||:.:..:.:..|.|:|.... .::...:..|:..:||..
plant   197 HKHTYLLSCSVDNKLVPRIDYFEKLGFSRRSATAMFKRFPQLFNYSIAENYEPKLKYLMVEMGRD 261

  Fly   282 HAQIVQCPELLA-SREFRLRERHE 304
            ..::::.|:..: |.|.|::.|||
plant   262 VREVLEFPQYFSFSLENRIKPRHE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 42/219 (19%)
EMB3114NP_850257.1 mTERF <151..307 CDD:418649 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.