DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT2G34620

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_181009.1 Gene:AT2G34620 / 818027 AraportID:AT2G34620 Length:303 Species:Arabidopsis thaliana


Alignment Length:272 Identity:62/272 - (22%)
Similarity:113/272 - (41%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITTKQNDKKTEPAECEGSKEVALDFRNREAHVPSFNLAAYVNNSSTLQ---QFLSLGVDLHSIER 108
            ::||....||                |..:| |.|.:|   :.:.|||   :.|.|  :|..|:.
plant    27 LSTKPTTIKT----------------NLHSH-PLFTVA---DQTVTLQMKEKILCL--ELMGIDS 69

  Fly   109 RKGLGDFVLK-------LDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDL-DDLQTRVN 165
            .|.|.   |.       ||   :::..:.||..:|:.|:|..|:....|.:...|: .:|.....
plant    70 GKALS---LNPCLCSAPLD---SIQSVLHFLQSKGIYPNDLPRILGMCPKILTSDVRTELYPVFM 128

  Fly   166 YLKSK-RFSDEARQRILTQNPYWLMFSTR-RVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNM 228
            :|.:. ...:.|.:|::.:.|..|:.|.. ::...|.|.|   :|...||..||.::|..:..::
plant   129 FLSNDLHVPENAFRRVIKKCPRLLISSVEDQLKPALFYLQ---RLGLKDLEALAYQDPILLVSSV 190

  Fly   229 EHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIP-PDDLVERFSYIHQDMGLPHAQIVQCPELL 292
            ||.........|.:||:..|...:::|.|.|.... .::...:..|...::......:.:.|:..
plant   191 EHTLIPKLRFLESIGFSRPEAIGMILRCPALFTFSIENNFKPKLDYFMSEIKGKLENLKEFPQYF 255

  Fly   293 A-SREFRLRERH 303
            | |.|.|::.||
plant   256 AFSLEKRIKPRH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 41/187 (22%)
AT2G34620NP_181009.1 mTERF 62..291 CDD:418649 49/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.