DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and EMB2219

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_179763.3 Gene:EMB2219 / 816708 AraportID:AT2G21710 Length:641 Species:Arabidopsis thaliana


Alignment Length:249 Identity:58/249 - (23%)
Similarity:112/249 - (44%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GDFVLKLDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVN-YLKSKRFSDEA 176
            ||.:|:.:.|: :...:.:|...||..|..|.:..:.|.|....::::::||: :||..      
plant   270 GDNILQRNREE-LNEIVEYLESNGVRRDWMGYVVGRCPELLSFSMEEVKSRVDFFLKMG------ 327

  Fly   177 RQRILTQNPYWLM----------FSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHL 231
                :.||.:..|          ||.:.:::::.|. |||.||..::..|...:|:.:..::|..
plant   328 ----MNQNDFGTMVYDYPKIIGFFSFQVMEKKINYL-KEFGLSTEEVGRLLAYKPHLMGCSIEER 387

  Fly   232 RKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQI----VQCPELL 292
            .|.:......:|...:.:..::|.||.|..|..:..:.......|:||:|:..|    |:.|.||
plant   388 WKPLVKYFYYLGIPKEGMKRILVVKPILYCIDLEKTIAPKVRFLQEMGIPNEAIGNMLVKFPSLL 452

  Fly   293 ASREFRLRERHEFLKLLGRA---QYDPQKDLYISPK-------TIVEGNNFYFV 336
            .:..:: :.|...:.||.||   |.|..|.:.:.|.       |.:|.|..|::
plant   453 TNSLYK-KIRPVVIFLLTRAGVTQKDIGKVIAMDPALLGCSIGTKLEPNMRYYI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 43/199 (22%)
EMB2219NP_179763.3 mTERF 285..593 CDD:303004 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4421
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.