DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and EMB93

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001324457.1 Gene:EMB93 / 814834 AraportID:AT2G03050 Length:284 Species:Arabidopsis thaliana


Alignment Length:262 Identity:51/262 - (19%)
Similarity:107/262 - (40%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SKEVALDFRNREAHVPSFNL-------------AAYVNNSSTLQQFL-SLGVDLHSIERRKGLGD 114
            :.:..:.||.:..::...|:             :|.:::..:::..| |.|:...::.|...:..
plant    26 TSDTGILFREKLIYLQDLNVDPHKALRVNPSLRSAPISSVVSVETLLSSTGLSRPAVGRILDMFP 90

  Fly   115 FVLKLDFEKNVKPYITFLVDQ-GVSPDDFGRMFTKNPLLFKEDLD-DLQTRVNYLKSKRFSDEAR 177
            .:|..|.|..:.|.:.||.:: .:|..|..:..::.|.|....:| .|:..:.:||:..|  ..|
plant    91 DLLTSDPESEILPVLRFLSNEISISEQDIPKSISRCPRLLISSVDYQLRPALTFLKTLGF--VGR 153

  Fly   178 QRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEM 242
            ..|.::|...|:.:..|.                                   |...:..|:|.:
plant   154 DTITSRNTVLLVSNVERT-----------------------------------LIPKIEYLEEGL 183

  Fly   243 GFNAKELSDLVVRKPRLLMIPPD-DLVERFSYIHQDMGLPHAQIVQCPELLA-SREFRLRERHEF 305
            ||..:|::.:|||.|.||....| :||.:..:..::|.....::.:.|:..: |.|.:::.||..
plant   184 GFTREEVAKMVVRSPALLTYSVDNNLVPKVEFFIEEMRGDVKELKRFPQYFSFSLERKIKPRHRL 248

  Fly   306 LK 307
            ||
plant   249 LK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 39/188 (21%)
EMB93NP_001324457.1 mTERF <72..269 CDD:418649 47/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294087at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.