DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and MTERF1

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_008911.1 Gene:MTERF1 / 7978 HGNCID:21463 Length:399 Species:Homo sapiens


Alignment Length:195 Identity:47/195 - (24%)
Similarity:94/195 - (48%) Gaps:17/195 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFS----DEAR-- 177
            |:.|.|:|    ||...|::.....|:.|..|..|...||..:..|.:|::...|    |.|.  
Human   174 LNLENNIK----FLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPADFV 234

  Fly   178 QRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNA--ITYNMEHLRKSVFTLKE 240
            ::|:.:||:.|:.||:||...:.:.:..|.|:..:|.:|.. .|.|  :..:.::.|:|...:||
Human   235 RKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLIC-GPGAEILDLSNDYARRSYANIKE 298

  Fly   241 E---MGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRER 302
            :   :|...:|:...|:..|.::.:......::...:.:: .:..:||::.|.:|.|....|:.|
Human   299 KLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEE-NISISQIIENPRVLDSSISTLKSR 362

  Fly   303  302
            Human   363  362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 46/192 (24%)
MTERF1NP_008911.1 mTERF 76..389 CDD:280667 47/195 (24%)
Interaction with DNA 169..170
Interaction with DNA 247..251 2/3 (67%)
Interaction with DNA 324..331 0/6 (0%)
Interaction with DNA 355..358 0/2 (0%)
Interaction with DNA 384..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.