Sequence 1: | NP_649240.1 | Gene: | mTerf3 / 40279 | FlyBaseID: | FBgn0037008 | Length: | 354 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008911.1 | Gene: | MTERF1 / 7978 | HGNCID: | 21463 | Length: | 399 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 47/195 - (24%) |
---|---|---|---|
Similarity: | 94/195 - (48%) | Gaps: | 17/195 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 LDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFS----DEAR-- 177
Fly 178 QRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNA--ITYNMEHLRKSVFTLKE 240
Fly 241 E---MGFNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRER 302
Fly 303 302 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mTerf3 | NP_649240.1 | mTERF | <122..307 | CDD:327630 | 46/192 (24%) |
MTERF1 | NP_008911.1 | mTERF | 76..389 | CDD:280667 | 47/195 (24%) |
Interaction with DNA | 169..170 | ||||
Interaction with DNA | 247..251 | 2/3 (67%) | |||
Interaction with DNA | 324..331 | 0/6 (0%) | |||
Interaction with DNA | 355..358 | 0/2 (0%) | |||
Interaction with DNA | 384..391 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1267 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |