DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and Mterf3

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_036014003.1 Gene:Mterf3 / 66410 MGIID:1913660 Length:418 Species:Mus musculus


Alignment Length:290 Identity:98/290 - (33%)
Similarity:156/290 - (53%) Gaps:9/290 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FCSALRNILRNSQNAAKNATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPAECEGSKE 66
            |.||..|..::|..:....::..|...:...:|.....||...|.::..|:..:.|..:......
Mouse    69 FHSASTNRTKSSAESTLLPSVAEQQERILSLESELPLEEVDDLPPLSPLQSVSEEEAIQIAAYSP 133

  Fly    67 VALDFRNREAHVPSFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITF 131
            :.         :.||.||.||::|.|||:.:.|||||..||:.....:.:|:|||||::|..:.|
Mouse   134 LP---------ISSFTLADYVDHSKTLQKLVQLGVDLSKIEKHPDAANLLLRLDFEKHIKQILLF 189

  Fly   132 LVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVD 196
            |.|.|:..:..|...|||..:|.|||::|:|||.||:||.||.....|::...|:.|.||..|:|
Mouse   190 LKDLGLEDNQLGPFLTKNYAIFSEDLENLKTRVAYLQSKNFSKTDIARMVKNAPFLLSFSVERLD 254

  Fly   197 RRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLM 261
            .|||:||||.:|:....|.|..|.|..:|.::|.:::::.....|:||...|:..:|::.|::|.
Mouse   255 NRLGFFQKELELNVKKTRDLVVRLPRLLTGSLEPVKENMKVYHLELGFKHNEIQHMVIKIPKMLT 319

  Fly   262 IPPDDLVERFSYIHQDMGLPHAQIVQCPEL 291
            .....|.|.|.|:|..|.:||..||:.|:|
Mouse   320 ANKRKLTEIFDYVHNVMNIPHHIIVKFPQL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 65/170 (38%)
Mterf3XP_036014003.1 mTERF <148..363 CDD:418649 80/202 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834685
Domainoid 1 1.000 151 1.000 Domainoid score I4356
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9310
Inparanoid 1 1.050 220 1.000 Inparanoid score I3556
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45846
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007491
OrthoInspector 1 1.000 - - oto93286
orthoMCL 1 0.900 - - OOG6_105045
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3723
SonicParanoid 1 1.000 - - X5616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.690

Return to query results.
Submit another query.