DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and mterf2

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001038293.2 Gene:mterf2 / 557469 ZFINID:ZDB-GENE-070424-91 Length:376 Species:Danio rerio


Alignment Length:287 Identity:63/287 - (21%)
Similarity:109/287 - (37%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEPAECEGSKE----VALDFRNREAHVP 79
            |.|:| .:|::...::|...|..|....|..|       |.:.|..|:    |..:.::....|.
Zfish    68 NETVT-LLRDIGANETVIARVLELHPEAILCK-------PEQMELQKQLWMSVCANNKDLVGIVE 124

  Fly    80 SFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVSPDDFGR 144
            .|..:.:.::|:            |  :.:|...::...|...|.:   |:.|:  ..:|..|.|
Zfish   125 KFPASFFTSSSN------------H--DNQKANIEYFQTLHLNKRI---ISKLM--ASAPQSFSR 170

  Fly   145 MFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEA---------RQRILTQNPYWLMFSTRRVDRRLG 200
            ...:|    :|.:..||        |.|.|..         .|::|||.||.|:..:..:...|.
Zfish   171 PVKQN----QEMIQTLQ--------KTFLDLGGNEDNMKVWLQKLLTQYPYVLLKPSDALCDNLT 223

  Fly   201 YFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPD 265
            :.......||..|.||:.........|.|.:|.::...:|.......||..:|::.|.||.....
Zfish   224 FLHNRGFTSGELLHLLSKLRGFVTELNPESMRLTLSYSQEMFRCTEDELRRIVLQCPALLYYSVP 288

  Fly   266 DLVERFSYIHQDMGLPHAQIVQCPELL 292
            .|.:||..: ...|:...||.:.|.:|
Zfish   289 ILADRFKGL-LSAGVSVEQITETPTVL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 44/180 (24%)
mterf2NP_001038293.2 mTERF 71..351 CDD:303004 61/284 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3723
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.