DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and MTERF3

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_057026.3 Gene:MTERF3 / 51001 HGNCID:24258 Length:417 Species:Homo sapiens


Alignment Length:274 Identity:111/274 - (40%)
Similarity:168/274 - (61%) Gaps:0/274 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVSPDDFGR 144
            ||.|..||::|.|||:.:.|||||..||:.....:.:|:|||||::|..:.||.|.|:..:..|.
Human   143 SFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGA 207

  Fly   145 MFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQKEFKLS 209
            ..|||..:|.|||::|:|||.||.||.||.....:::.:.|:.|.||..|:|.|||:||||.:||
Human   208 FLTKNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELS 272

  Fly   210 GHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVERFSYI 274
            ....|.|..|.|..:|.::|.:::::...:.|:||...|:..::.|.|::|......|.|.|.::
Human   273 VKKTRDLVVRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFV 337

  Fly   275 HQDMGLPHAQIVQCPELLASREFRLRERHEFLKLLGRAQYDPQKDLYISPKTIVEGNNFYFVRNV 339
            |..|.:||..||:.|::..:|.|:::|||.||..||||||||.|..|||...:|...:..|...:
Human   338 HNVMSIPHHIIVKFPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEI 402

  Fly   340 AKSDLETFDLFLKT 353
            ||:.::.|:.||||
Human   403 AKASVQDFEKFLKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 69/184 (38%)
MTERF3NP_057026.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..96
mTERF <159..398 CDD:327630 94/238 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144565
Domainoid 1 1.000 149 1.000 Domainoid score I4442
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9310
Inparanoid 1 1.050 214 1.000 Inparanoid score I3634
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45846
OrthoDB 1 1.010 - - D1294087at2759
OrthoFinder 1 1.000 - - FOG0007491
OrthoInspector 1 1.000 - - oto89717
orthoMCL 1 0.900 - - OOG6_105045
Panther 1 1.100 - - LDO PTHR13068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3723
SonicParanoid 1 1.000 - - X5616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.