DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and mterf3

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_012820668.2 Gene:mterf3 / 394691 XenbaseID:XB-GENE-6454740 Length:418 Species:Xenopus tropicalis


Alignment Length:345 Identity:124/345 - (35%)
Similarity:194/345 - (56%) Gaps:16/345 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NATITSQIRNLRGQQSVHHEVEVLTSPGITTKQNDKKTEP--------AECEGSKEVALDFRNRE 75
            :||:....:||...:....|.:||......|...|.:..|        .|.|.: ::|.|.    
 Frog    79 DATVMFSEQNLPSIKLYPQETKVLPGTDFNTLSEDLEGAPPLSPLEEITENEAA-QIAADL---- 138

  Fly    76 AHVP--SFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVS 138
             .:|  ||.|..||:.|.||::.:.|||||..:|:|..:.:|:|:||||::|..::.||.|.|:.
 Frog   139 -PIPPASFTLQDYVDQSETLKKLVLLGVDLSKLEKRPNVANFLLRLDFERDVSRFLLFLKDVGLE 202

  Fly   139 PDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQ 203
            ....|...:|||.:..|||::||.||:||:.|.||.||..|::.:.||.|.||..|:|.|||:||
 Frog   203 DSQLGAFLSKNPFILSEDLENLQKRVSYLRLKEFSKEAVARMVAKAPYLLNFSIERLDNRLGFFQ 267

  Fly   204 KEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLV 268
            :|..||....|.|..|.|..:|.::|.:|:::...:.|:||...|:..:.::.|::|......|:
 Frog   268 RELGLSTEKTRDLIIRLPRLLTGSLEPVRENLKVCEIELGFKKNEIQHIAIKVPKILTANKKKLM 332

  Fly   269 ERFSYIHQDMGLPHAQIVQCPELLASREFRLRERHEFLKLLGRAQYDPQKDLYISPKTIVEGNNF 333
            |.|.|:|..||:||..||:.|::..::..:::|||.||..||||.|||.|..|:|...:....|.
 Frog   333 ETFDYVHNIMGIPHHLIVKFPQVFNTKLLKMKERHLFLGFLGRAVYDPTKPNYVSLDKLTSTPNE 397

  Fly   334 YFVRNVAKSDLETFDLFLKT 353
            .|...|||:.::.::.||||
 Frog   398 IFCVEVAKASVQDYERFLKT 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 69/184 (38%)
mterf3XP_012820668.2 mTERF <179..367 CDD:418649 71/187 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4518
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9310
Inparanoid 1 1.050 213 1.000 Inparanoid score I3543
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294087at2759
OrthoFinder 1 1.000 - - FOG0007491
OrthoInspector 1 1.000 - - oto103530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5616
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.