DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and Mterf2

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_038935604.1 Gene:Mterf2 / 366856 RGDID:1311836 Length:394 Species:Rattus norvegicus


Alignment Length:201 Identity:45/201 - (22%)
Similarity:82/201 - (40%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 EKNVKPYITFLVDQGVSPDDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFS---DEARQRI--- 180
            ::|.|..:.|..:.|:......|..|....:|...:::.:..:..|.....:   .||..::   
  Rat   155 QENQKLNVQFFQELGLKNVVITRFLTTASSIFHNPVENNKQMIGVLLESYLNLGGSEANAKVWLL 219

  Fly   181 --LTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMG 243
              |:|||:.::.|...|...|.:.|.:.......|:||:..:..........::.|:...|....
  Rat   220 KLLSQNPFIVLSSPTAVGEVLKFLQGQGFTDSEVLQLLSKLKGFLFQLQPGSIQNSISFTKTTFE 284

  Fly   244 FNAKELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASR----EFRLRERHE 304
            ....:|..|||:.|.||..|...|.||...:.:: |:..|||...|.:|...    ::|:|:   
  Rat   285 CTDHDLRQLVVKCPALLYYPAPVLEERIQALLKE-GISVAQIRASPMVLELTPQIIQYRIRK--- 345

  Fly   305 FLKLLG 310
             |..||
  Rat   346 -LNSLG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 42/196 (21%)
Mterf2XP_038935604.1 mTERF 93..369 CDD:418649 45/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.