DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and AT1G62085

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001319292.1 Gene:AT1G62085 / 2745844 AraportID:AT1G62085 Length:461 Species:Arabidopsis thaliana


Alignment Length:194 Identity:43/194 - (22%)
Similarity:88/194 - (45%) Gaps:10/194 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KLDFEKNVKPYITFLVDQGVSPDDFGRMFTKN-PLLFKEDLDDLQTRVNYLKSKRFSDEARQRIL 181
            |.:||:::|.    :|:.|..|..  ..|.|. .::::.....::.:||..||..||......:.
plant   225 KENFEESLKK----VVEMGFDPTT--SKFVKALRVVYRFRDKTIEAKVNVCKSLGFSVGDVWAMF 283

  Fly   182 TQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNA 246
            .:.|.:|.||..::.:..... |:..|...|:..:..:.|..|..:.:.:..|:.|.. .:||:.
plant   284 KKCPSFLNFSENKIVQTWETL-KKCGLLEDDVLSVLKKFPQCINASEQKIMNSIETFL-GLGFSR 346

  Fly   247 KELSDLVVRKPRLLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLA-SREFRLRERHEFLKLL 309
            .|::.:..|.|:.|::..:.:.::..::.:.|..|...:|..|.:|. |.|.|...|...:|.|
plant   347 DEVAMIAKRFPQCLILSAETVKKKTEFLVKKMNWPLKAVVSTPAVLGYSLEKRTIPRCNVIKAL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 39/186 (21%)
AT1G62085NP_001319292.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.