DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and mterf1

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_003200550.2 Gene:mterf1 / 100536997 -ID:- Length:393 Species:Danio rerio


Alignment Length:320 Identity:69/320 - (21%)
Similarity:117/320 - (36%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NLAAYVNNSSTLQQFLSLGVDLHSIERR------------KGLGDF------------------- 115
            |:.....|...|:...||||||.|..||            :||..|                   
Zfish    59 NVDPAAENKCLLESLSSLGVDLSSARRRHPGVLKRALTNEQGLARFLQSKGADAAAVASIISRFP 123

  Fly   116 -------------------VLKLDFE------------------KNVKPYITFLVDQGVSPDDFG 143
                               :.:.|.|                  ||::..||||...|::|.|..
Zfish   124 RCITRSSKHLQERWSLWRSIFQSDGEMVEILSRSPESFFRSSDNKNLEENITFLKSLGITPKDLH 188

  Fly   144 RMFTKNPLLFKEDLDDLQTRVNYLKS----------KRFSDEARQRILTQNPYWLMFSTRRVDRR 198
            |:.|..|..|...:...:..|..|:|          |.|:    :.|:::|.|..:.||.|:...
Zfish   189 RLLTTAPRTFSNSVALNRNMVELLQSVCASLGGDNEKEFA----RIIISKNLYIFIRSTNRIRAN 249

  Fly   199 LGYFQKEFKLSGHDLRLLATREPNAITYNMEH--LRKSVFTLK---EEMGFNAKELSDLVVRKPR 258
            :.:...|.|||..:.::. .:...|:..::.|  |:|:...|:   ..:|...::|..::: |..
Zfish   250 VDFLLSEMKLSDSEAQVF-LQSHGALILDLSHESLKKNFQNLRLKLRSLGCGEEDLRKMIL-KFS 312

  Fly   259 LLMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRERHEFLKLLGRAQYDPQK 318
            |::.....|:........|.|:...|::..|::|......:|.|.|.|:.|   .||.||
Zfish   313 LVLFMSAQLLNTKLDCFLDAGINIQQLILKPKVLDFSVENIRRRLEQLRAL---DYDFQK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 47/217 (22%)
mterf1XP_003200550.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.