DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mTerf3 and mterf4

DIOPT Version :9

Sequence 1:NP_649240.1 Gene:mTerf3 / 40279 FlyBaseID:FBgn0037008 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001119940.1 Gene:mterf4 / 100000849 ZFINID:ZDB-GENE-070912-693 Length:316 Species:Danio rerio


Alignment Length:276 Identity:63/276 - (22%)
Similarity:115/276 - (41%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVSPDDFGRMFTKNPLLF 153
            |..||...|.:|......|.   :.:..|| ...|:|...:|.|...|.:|....::..|.|.::
Zfish    55 NQLTLCSLLQMGFSQTQAEE---MHEAALK-SRGKHVPSVLTALFVLGFNPSSVLKILQKCPEVY 115

  Fly   154 KEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDLRLLAT 218
            ....::||.|:..|:.....:.:.||:::..|..::...:||                       
Zfish   116 SAKGEELQQRILNLRKMGLVEGSLQRMISHYPKVMVLPLKRV----------------------- 157

  Fly   219 REPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRLLMIPPDDLVE---RFSYIHQDMGL 280
               ||::.          .|||:..|..:::::::...|.:|   .:||.:   :..|.:..||:
Zfish   158 ---NAVSR----------LLKEKCHFTTQQVTEILRNSPEVL---EEDLAQLEYKIQYTYFRMGV 206

  Fly   281 PHAQIVQCPELLASREFR-----LRERHEFLKLLGRAQYDPQK--DLYISP--KTIVEGNNFYFV 336
            ..|::|:      |:.||     ||.||.||:..|..|...:|  .|.::|  |.|:..:...|:
Zfish   207 RQAEMVK------SKLFRLPVSELRCRHSFLERRGLYQTPDKKGQTLILNPPLKDILCASEETFL 265

  Fly   337 RNVAKSDLETFDLFLK 352
            ..||.::.|.|:.|.|
Zfish   266 MQVASANAEEFNAFRK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mTerf3NP_649240.1 mTERF <122..307 CDD:327630 40/192 (21%)
mterf4NP_001119940.1 mTERF <97..>186 CDD:303004 20/124 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.