DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and AQR1

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_014334.3 Gene:AQR1 / 855660 SGDID:S000005009 Length:586 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:60/311 - (19%)
Similarity:109/311 - (35%) Gaps:98/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFGLKKLLVSLASTSGIGKPSVGHILVVVFLEYFAWGLLTMPMIATLKETFPDHTFLMNGLVMGV 67
            |:|:..:|......|.:|.|                  :..|.:..|::.|.....::|..|: |
Yeast    99 KWGMVAILTMCGFWSSLGSP------------------IYYPALRQLEKQFNVDENMVNVTVV-V 144

  Fly    68 KGILSFLSSPLIGALSDIYGRKVLLLITVIFTSLPIPMMTMDNWWFFVISSIS-------GV--- 122
            ..:...:|..:.|.|:|.:||:.::|..::               .:||:||.       ||   
Yeast   145 YLLFQGISPTVSGGLADCFGRRPIILAGML---------------IYVIASIGLACAPSYGVIIF 194

  Fly   123 ------LGVSFSVAFA--YVADVTTKEERSRSYELVSATFAASLVIAPAMGNLI----MDRYGIN 175
                  :|:|.::|.:  .|.|.|.|.||.   ..|.|| :..:::....|:||    ..|:...
Yeast   195 LRCIQSIGISPTIAISSGVVGDFTLKHERG---TFVGAT-SGFVLLGQCFGSLIGAVLTARWDWR 255

  Fly   176 TVVLVATLVSTTNVMFVLLAVPET--------------------------LQQNVRSTGLSWKQA 214
            .:....|:...:..:...|.:|||                          :::..:.....::..
Yeast   256 AIFWFLTIGCGSCFLIAFLILPETKRTIAGNLSIKPKRFINRAPIFLLGPVRRRFKYDNPDYETL 320

  Fly   215 DPF---LSLRRVGSD---PNVLL------LCVVMFTFLLPEAGEYSSVPAY 253
            ||.   |.|...|..   |.::|      |...|:|.:|.......||..|
Yeast   321 DPTIPKLDLSSAGKILVLPEIILSLFPSGLLFAMWTLMLSSISSGLSVAPY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 54/287 (19%)
MFS_1 27..368 CDD:284993 54/287 (19%)
AQR1NP_014334.3 MFS_Tpo1_MDR_like 103..553 CDD:340881 58/307 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.