DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and MEE15

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001323497.1 Gene:MEE15 / 816200 AraportID:AT2G16970 Length:460 Species:Arabidopsis thaliana


Alignment Length:483 Identity:107/483 - (22%)
Similarity:183/483 - (37%) Gaps:111/483 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HILVVVFLEYFAWGLLTMPMI---------ATLKETFPDHTFLMNGLVMGVKGILSFLSSPLIGA 81
            |:|..|||..|: ..|..|::         :.|.||.....:| .|:.....|:.:.:..|:||.
plant    11 HLLTTVFLSGFS-EFLVKPVMTDVTVAAVCSGLNETCSLAVYL-TGVEQVTVGLGTMVMMPVIGN 73

  Fly    82 LSDIYGRKVLLLITVIFTSLPIPMMTM---DNWWFFVISSISGVL------GVSFSVAFAYVADV 137
            |||.||.|.||.:.:..:.||..::..   .|  ||....|:.:|      |....:|.||||..
plant    74 LSDRYGIKTLLTLPMCLSILPPAILAYRRDTN--FFYAFYITKILFDMVCQGTVDCLAHAYVAKN 136

  Fly   138 TTKEER---------SRSYELVSATFAASLVIAPAMGNLIMDRYGINTVVLVATLVSTTNVMFVL 193
            ....:|         .||...|.|||:|.|:             .|.::..||.:.....::::.
plant   137 VCGRKRISMFGVLAGVRSISGVCATFSARLL-------------PIASIFQVAAISFFFGLVYMR 188

  Fly   194 LAVPETLQ---------------QNVRSTGLSWKQADPFL----------------SLRRVGS-- 225
            :.:.|.|.               :|....|.....|:|.|                ||:.:.|  
plant   189 VFLKERLHDDDEDDCDEDDNTSGRNHHDGGDLTMLAEPILRDAPTKIHIVLNTKYSSLKDMVSLI 253

  Fly   226 -DPNVLL-LCVVMFTFLLPEAGEYSSVPAYLKLTMGFDFTELSTLVAFMAILG-ISINVTLGSIV 287
             :..:|: ..||.|.....::|..|:...:||...||:..:.:.|:..:.|:| ||....|..:|
plant   254 KNSTILVQTLVVTFFATFAQSGMQSAFLYFLKARFGFNKNDFAELILLVTIIGSISQLFILPKLV 318

  Fly   288 KTLGAKNAIILGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITFPAVSAYVSLYTDVETQGAV 352
            ..:|.:..:..|||::.:.....::.:..|..:....:..::....|:|....|.......||.|
plant   319 SAIGERRVLSTGLLMDSVNAACLSVSWSAWVPYATTVLVPVTMFVMPSVCGIASRQVGPGEQGKV 383

  Fly   353 QGMITGMSGLCSGLGPALFGIV----------FYLSDMDLDKNRILIGSVSGDRTVTNPFMIGAI 407
            ||.|:|:......:.|.::..:          ||.....|             ..||...|||  
plant   384 QGCISGVKSFSGVVAPFIYSPLTALFLSEKAPFYFPGFSL-------------LCVTFSLMIG-- 433

  Fly   408 SVFIGILLASYIPDEKVSRG----RREE 431
             .|:.:|:.. :|...:::.    .|||
plant   434 -FFLSLLIRD-VPSPSMNKAINNISREE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 92/420 (22%)
MFS_1 27..368 CDD:284993 91/403 (23%)
MEE15NP_001323497.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2614
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I2229
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D582396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1054
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23504
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.