DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and Slc46a3

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001343931.1 Gene:Slc46a3 / 71706 MGIID:1918956 Length:460 Species:Mus musculus


Alignment Length:357 Identity:68/357 - (19%)
Similarity:133/357 - (37%) Gaps:98/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MNGLVMGVKGILSFLSSPLIGALSDIYGRKVLLLITVI-------------FTSLPIPMMTMDNW 111
            |:.|:.|:......|:|      ||.:|||:.::::.:             :..||:.::....:
Mouse    78 MSALIPGLVSTFMLLAS------SDNHGRKLPMVLSSLGSLGTNTWLCMMSYFDLPLQLLIASTF 136

  Fly   112 WFFVISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLV---IAPAMGNLIMD--- 170
                |.::.|.....:...|||:.| ..||.:.|...:....|...:|   ...:.|..|.:   
Mouse   137 ----IGALFGNYTTFWGACFAYIVD-QQKEYKHRIIRIAILDFMLGVVTGLTGLSSGYFIRELGF 196

  Fly   171 --RYGINTVVLVATL----------VSTTNVMFVLLAVPETLQQNVRSTGLSWKQADPFLSLRRV 223
              .|.|..:||:..|          :..::...|.::..|:|:.....|.:.:|.          
Mouse   197 VWSYFITAMVLIVNLAYILFFLNDPIKESSSQIVTMSCIESLKDLFYRTYMLFKN---------- 251

  Fly   224 GSDPNVLLLCVVMFT--------------FLLPEAGE----------YSSV---PAYLKLTMG-- 259
            ||.....|||:::||              |.|.|.|.          |.|.   .::|...:|  
Mouse   252 GSSKRQALLCLLIFTLVIYFFVIIGISPIFTLYELGPPLCWNEVYIGYGSALGSVSFLSSFLGIW 316

  Fly   260 -FDFTELSTLVAFMAILGISINVTLGSIVKTLGAKNAIILGLL----------LELLQLILFAIG 313
             |.:......:|::.|....:.:||.:..:|     .:::.|:          |.:|:.:|..:.
Mouse   317 LFSYCLKDIHIAYIGIFTTMVGMTLAAFTRT-----TLMMFLVRIPFIFTIMPLSVLRSMLSKVV 376

  Fly   314 YEKWQMWLAGNVAALSSIT-FPAVSAYVSLYT 344
            :...|..|...:|.|.::. ..:.|||..:|:
Mouse   377 HSTEQGALFACIAFLETLAGVTSTSAYSGIYS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 68/357 (19%)
MFS_1 27..368 CDD:284993 68/357 (19%)
Slc46a3NP_001343931.1 MFS 3..437 CDD:391944 68/357 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.