DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and SLC46A2

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_149040.3 Gene:SLC46A2 / 57864 HGNCID:16055 Length:475 Species:Homo sapiens


Alignment Length:424 Identity:87/424 - (20%)
Similarity:171/424 - (40%) Gaps:94/424 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FLMNGLVMGVKGILSFLSSPLIGALSDIYGRKV---LLLITVIFTSLPIPMMTMDNWWFFVI--- 116
            :::..||:|:..:||...   :|.|||.|.||:   :.|:..:.:.|.:.:..:.:|...|:   
Human    78 YIIYNLVVGLSPLLSAYG---LGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGA 139

  Fly   117 SSISGVLGVSFSVAFAYVADVTT--KEERSRSYELV-------SATFAASLVIAPAMGNLIMDRY 172
            ::::|:.| .||..::.|..:.:  ..|..||..|:       .|.|..|:    |.|:|.....
Human   140 AALNGLFG-GFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSM----ASGHLFKQMA 199

  Fly   173 GINTVVLVATLVSTTNVMFVL------LAVPETLQQ---------NVRSTGLSWKQADP--FLSL 220
            |.:...|:.|..|.:...|.|      |.|||::.:         .|..|..:::..||  ....
Human   200 GHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQ 264

  Fly   221 RRVGSDPN----------VLLLCVVMFTFLLPEAGEYSSVPAY-LKLTMGFDFTELSTLVAFMAI 274
            ..||..|:          :.||.|....:.|...|....:|.: |:..:|::..:    |.:...
Human   265 YAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQ----VGYGMA 325

  Fly   275 LGISINVT--LGSIV--KTLGAKNAIILGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITFPA 335
            .|.:|.:|  ||.:|  :.......|::|::......:|.|...|.:..::|..|...:.|....
Human   326 AGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTT 390

  Fly   336 V----------SAYVSLYTDVETQGAVQGMITGMSGLCSGLGPALFGIVFYLSDMDLDKNRILIG 390
            :          |:|..::..::...|:.|::|.          .|:..::.|: ||:     .:|
Human   391 IRSAMSKLIKGSSYGKVFVILQLSLALTGVVTS----------TLYNKIYQLT-MDM-----FVG 439

  Fly   391 SVSGDRTVTNPFMIGAISVFIGILLASYIPDEKV 424
            |.         |.:.:...|:.|:..|.:..::|
Human   440 SC---------FALSSFLSFLAIIPISIVAYKQV 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 77/373 (21%)
MFS_1 27..368 CDD:284993 76/366 (21%)
SLC46A2NP_149040.3 MFS_1 84..421 CDD:284993 74/348 (21%)
MFS <282..453 CDD:304372 36/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.