DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and mfsd8l2

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_009295888.1 Gene:mfsd8l2 / 565645 ZFINID:ZDB-GENE-070705-179 Length:481 Species:Danio rerio


Alignment Length:459 Identity:98/459 - (21%)
Similarity:173/459 - (37%) Gaps:124/459 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FLMNGLVMGVKGILSFLSSPLIGALSD-IYGRKVLLLITVIFTSLPIPMMTMDNWWFFVISS--I 119
            |..:|||.|          |:.|..|| ....|.::|.:.:|..:...|..|....:.::||  :
Zfish    53 FSFSGLVTG----------PVFGHWSDKTRTTKTIILFSNVFEIVGNFMYFMGYSKWLLLSSRLV 107

  Fly   120 SGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVIAPA-----------MGNLIMDRYG 173
            :|:...:.|..|.::...|..:||:|.:..|.|...|.|:|.||           :|..|:::|.
Zfish   108 AGIGAGAGSSIFGFLTRTTLPDERARVFAAVMACRQAGLLIGPAFNIFLRLCDFKLGPFIVNKYT 172

  Fly   174 INTVVLVAT-LVSTTNVMFVLLAVP---ETLQQNVRSTGLSWKQADPFLSLR---RVG------- 224
            ...:.:... |:....||.:...:|   ...:|.:....:..::.:|.:||.   |..       
Zfish   173 SPGLFMCGMWLLMQFAVMGLYWDIPPLDSFAEQQMPLREVRGEEDEPLMSLEDDDRTAVADSYGS 237

  Fly   225 --------------------------SDP--------------NVLLLCVVMFTFLLPEAGEYSS 249
                                      |||              .|:||.....|.....|.|...
Zfish   238 LNPEQTETQLSSQIPPSPPESPPPDTSDPFENFSASREFLREEVVVLLTAQFITLFNQTALETMV 302

  Fly   250 VPAYLKLTMGFDFTELSTLVAFMAILGISINVTLGSIV-----KTLGAKNAIILGLLL---ELLQ 306
            .|...|.   |.|.||...|.: ::.|  :.|..|..:     :.|..:..:.:|||:   ..:.
Zfish   303 TPLTQKY---FGFGELGNSVMY-SLCG--VEVIAGFFLVRWLSRVLEDRVVLAVGLLICSGACVW 361

  Fly   307 LILF------AIGYEKWQMWLAGNVAALSSITFPAVSAYVSLYTDV---ETQGAVQGMITGMSGL 362
            .::|      .:|:|.:: ::.|....|..:.|.||| .|||::.|   :|||..||:...:.||
Zfish   362 CLIFLANPQGGLGFELFE-FIIGVFLQLLGLPFVAVS-QVSLFSKVTAEKTQGFSQGVRRSVGGL 424

  Fly   363 CSGLGPALFGIVFYLSDMDLDKNRILIGSVSGDRTVTNPFMIGAISVFIGILLASYIPDEKVSRG 427
            .:.|||                  :..|.:.|:..|....|:..:::.:.:::.||   ||:...
Zfish   425 ATILGP------------------LWAGGLIGNLYVMLGMMMLLLTLIMIMMVLSY---EKLVEP 468

  Fly   428 RREE 431
            .|.|
Zfish   469 PRVE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 88/401 (22%)
MFS_1 27..368 CDD:284993 86/394 (22%)
mfsd8l2XP_009295888.1 MFS 11..>194 CDD:119392 36/150 (24%)
MFS_1 14..430 CDD:284993 86/394 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.