DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and mfsd14ba

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_002663499.2 Gene:mfsd14ba / 557306 ZFINID:ZDB-GENE-200414-1 Length:500 Species:Danio rerio


Alignment Length:426 Identity:220/426 - (51%)
Similarity:296/426 - (69%) Gaps:31/426 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GIGKPSVGHILVVVFLEYFAWGLLTMPMIATLKETFPDHTFLMNGLVMGVKGILSFLSSPLIGAL 82
            |||||||.|.:||:|||:|||||||.||:..|.||||.||||:|||:.||||:|||:|:||||||
Zfish    43 GIGKPSVYHAVVVIFLEFFAWGLLTTPMLTVLHETFPTHTFLINGLIQGVKGLLSFMSAPLIGAL 107

  Fly    83 SDIYGRKVLLLITVIFTSLPIPMMTMDNWWFFVISSISGVLGVSFSVAFAYVADVTTKEERSRSY 147
            ||::||:..||:||.||..|||:|.:..||:|.:.|:||...|:|||.|||:||||.:.|||.:|
Zfish   108 SDVWGRRSFLLVTVFFTCAPIPLMRLSPWWYFAMISVSGAFSVTFSVIFAYIADVTDERERSTAY 172

  Fly   148 ELVSATFAASLVIAPAMGNLIMDRYGINTVVLVATLVSTTNVMFVLLAVPETLQQNVR----STG 208
            .|||||||||||.:||:|..:...||.|.|||||||::..::.|:||||||:|...:|    ...
Zfish   173 GLVSATFAASLVTSPAIGAYLSASYGDNLVVLVATLIALADICFILLAVPESLPDKMRLNTWGAP 237

  Fly   209 LSWKQADPFLSLRRVGSDPNVLLLCVVMFTFLLPEAGEYSSVPAYLKLTMGFDFTELSTLVAFMA 273
            :||:|||||.|||:||.|..|||:|:.:|...|||||:|||...||:..:.|   ...|:..|:.
Zfish   238 ISWEQADPFASLRKVGQDTTVLLICITVFLSYLPEAGQYSSFFLYLRQVINF---SPKTIAVFIG 299

  Fly   274 ILGI------SINVTLGSIVKTLGAKNAIILGLLLELLQLILFAIGYEKWQMWLAGNVAALSSIT 332
            ::||      ::.:||  :::|:|.||.::|||..::|||..:.:|.|.|.||.||.|||:||||
Zfish   300 VVGILSILAQTLFLTL--LMRTIGNKNTVLLGLGFQILQLAWYGLGSEPWMMWAAGAVAAMSSIT 362

  Fly   333 FPAVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPALFGIVFYLSDMDLDKNRILIGSVSGD-- 395
            ||||||.||...|.:.||.|||||||:.|||:||||||:|.||:|.:::|..    |..:..|  
Zfish   363 FPAVSALVSRSADPDKQGLVQGMITGIRGLCNGLGPALYGFVFFLFNVELSG----ITPIQPDFA 423

  Fly   396 ---RTVTN-------PFMIGAISVFIGILLASYIPD 421
               :|.|.       ||::||.:|.:..::|.:|||
Zfish   424 IPIQTPTEKTTIPGPPFLLGACTVVVAFIVALFIPD 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 195/357 (55%)
MFS_1 27..368 CDD:284993 190/350 (54%)
mfsd14baXP_002663499.2 MFS 52..409 CDD:119392 198/361 (55%)
MFS_1 54..398 CDD:284993 190/348 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53596
OrthoDB 1 1.010 - - D139531at33208
OrthoFinder 1 1.000 - - FOG0001490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102321
Panther 1 1.100 - - O PTHR23504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.