DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and si:dkey-5g14.1

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_009303600.1 Gene:si:dkey-5g14.1 / 556497 ZFINID:ZDB-GENE-091204-361 Length:463 Species:Danio rerio


Alignment Length:342 Identity:75/342 - (21%)
Similarity:139/342 - (40%) Gaps:38/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILSFLSSPLIGALSDIYGRKVLLLI----TVIFT--SLPIPMMTMDNWWFFV---ISSISGVLGV 125
            |.|.:.:.|:.:.||..|||:.:::    |:|:|  .|.:....::.:...|   :|::.|.:|.
Zfish    82 IPSLIVTLLLVSYSDQRGRKITIIMPLIGTLIYTLSFLTVSFFQLNLYLLIVASFVSALFGGIGT 146

  Fly   126 SFSVAFAYVADVTTK-EERSRSYELVSATFAASLVIAPAMGNLIMDRYGINTVVLVATLVSTTNV 189
            .....|:||||:... ::::....:|.........:|.......:...|.|.....:.:....|:
Zfish   147 MLGGCFSYVADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNL 211

  Fly   190 MFVLLAVPETLQQNVRSTGLSWKQ-----ADPFLSLRRVGSDPN--VLLLCVVMFTFL-LPEAGE 246
            ::.:..:.||...: ||..|:..|     |....||...||...  ||:|.::.|:.| ....|.
Zfish   212 LYAIFILEETRVID-RSETLACCQALRNLACSIYSLFAGGSRRRTWVLVLLIITFSSLSFVNTGG 275

  Fly   247 YSSVPAYLKLTMGFDFTELSTLVAFMAILGISINVT--LGSIVKTLGAKNAII--LGLLLELLQL 307
            .|....| :|.....:||:  ||.:.:....||.:|  :|..:.:|...|..|  :|:|...:.:
Zfish   276 LSIFTLY-ELNEPLCWTEI--LVGYGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGMLSVAVSM 337

  Fly   308 ILFAIGYEKWQMWLAGNVAALSSITFPAVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPALF- 371
            ::.........|:|....|..:.:.||.:.:.:|.......|||:...:.....|.:....|.| 
Zfish   338 LMTGFAKTTLTMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFS 402

  Fly   372 -----------GIVFYL 377
                       |.||.|
Zfish   403 RIYAATVAWCPGFVFLL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 72/338 (21%)
MFS_1 27..368 CDD:284993 69/319 (22%)
si:dkey-5g14.1XP_009303600.1 MFS 79..435 CDD:119392 75/342 (22%)
MFS_1 81..393 CDD:284993 68/314 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.