DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and slc46a1

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_956579.1 Gene:slc46a1 / 393255 ZFINID:ZDB-GENE-040426-1012 Length:481 Species:Danio rerio


Alignment Length:441 Identity:97/441 - (21%)
Similarity:173/441 - (39%) Gaps:110/441 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IATLKETFPDHTFL---MNGLVMGVKGILSFLSSPLIGALSDIYGRKVLLLI------------- 94
            :.|..||...|..|   :.|.::|:..::      |:|:.||..||:::|:|             
Zfish    94 LQTEVETLTAHWSLYINLGGFLVGLFMVI------LLGSWSDRAGRRLVLIIPSLGLAVQAAVYL 152

  Fly    95 TVIFTSLPIPMMTMDNWWFF---VISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAA 156
            ||::..||:       :||.   :.|.:||......:..||||||  |.|..||::.:  |...|
Zfish   153 TVMYLKLPV-------FWFLIGRICSGLSGDFNAILAGCFAYVAD--TSERGSRTFRV--AILEA 206

  Fly   157 SLVIAPAMGNLIMDRYG-----INTVVLVATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQADP 216
            .|.:|....::|..::.     ||...||.. .:.|..::..|.||||:..:.::...|.:....
Zfish   207 CLGLAGMFASIIGGQWRRAQGYINPFWLVLA-TNLTAALYAYLFVPETVTPDPQARLFSTRHHQA 270

  Fly   217 FLSLRRVGSDPN------VLLLCVVMFT---------FLL----------PEAGEYSSVP---AY 253
            ...|....:.|.      :.:||..:..         ::|          ||...|.|..   ||
Zfish   271 VCRLYSSDAPPGRRSKLWLYILCFFLVVTVHLGCSDLYVLYELSAPLCWGPELIGYGSAAKHLAY 335

  Fly   254 LKLTMGFDFTELSTLVAFMAILGISINVTLGSIVKTLGAKNAIILGLLLELLQLILFAIGYEKWQ 318
            |....|....:.....:::|::|::.|: :|.:|.::....|::.             .||....
Zfish   336 LTSLTGLRAMQCCLEDSWVALVGLTSNM-VGLVVISVADTTALMF-------------TGYGLCF 386

  Fly   319 MWLAGNVAALSSITFPAVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPALFGIVFYLSDMDLD 383
            :::|..         |.:.:.:|...|...|||:...:..:.||||.:...:|. ..|.:.:...
Zfish   387 LFMAST---------PVLRSKLSKLVDPAEQGALFASVACVEGLCSLVSSGVFN-ALYPATLHFM 441

  Fly   384 KNRILIGSVSGDRTVTNPFMIGAISVFI--GILLASYIPDEKVSRGRREEF 432
            |.              .||:.||..:.|  ||:......:::.||..||.|
Zfish   442 KG--------------FPFVFGAAILLIPAGIIGGLGCQEKRESRENREGF 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 83/380 (22%)
MFS_1 27..368 CDD:284993 82/373 (22%)
slc46a1NP_956579.1 MFS 93..460 CDD:119392 91/421 (22%)
MFS_1 114..427 CDD:284993 76/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.