DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and CG12194

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001162873.1 Gene:CG12194 / 33685 FlyBaseID:FBgn0031636 Length:496 Species:Drosophila melanogaster


Alignment Length:337 Identity:65/337 - (19%)
Similarity:118/337 - (35%) Gaps:105/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FGLKKLLVSLASTSG--IGKPSVGHIL----------VVVFLEYFAWGLLTMPMIATLKETFPDH 56
            |||:..:....||..  |.:|..|::.          |.:||   |.....|.::.||       
  Fly   189 FGLQLSVARFGSTVNFWIMQPLYGYVSKSYSGYKGLGVALFL---ASSTCVMSLVCTL------- 243

  Fly    57 TFLMNGLVMGVKGILSFLSSP--LIGALSDIYGRKVLLLITVIFTSLPIPMMTMDNWWFFVISSI 119
              ::..:....:.||...::|  .:..||||...|                  :|.|...|:.  
  Fly   244 --ILGWMDKRAERILKRNNNPGGELAKLSDIVTFK------------------LDFWMVSVVC-- 286

  Fly   120 SGVLGVSFSVA-FAYVA----------DVTTKEERSRSYELVSATFAASLVIAPAMGNLIMDRYG 173
                 |::.|| |.:||          .:|..|..:    :.|..:..|.:.:|..| .::|:.|
  Fly   287 -----VAYYVAIFPFVALGQAFFVSNFHMTPDEANT----VNSIVYLISAIASPLFG-FVIDKVG 341

  Fly   174 INTVVLVATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQADPFLSLRRVGSDPNVLLLCVVMFT 238
            .|...:....:||....|:                |::...||::.:..:|...::|...:....
  Fly   342 RNVTWVFCATISTLLAHFL----------------LTFTHLDPYIGMSIMGLSYSMLAASLWPLV 390

  Fly   239 FLLPEAGEYSSVPAYLKLTMGFDFTELSTLVAF---MAILGIS-INVTLGSIVKTLGAKNAIILG 299
            .|:        ||.|          :|.|...|   :..||:: :.:..|.||.:.|..:..:..
  Fly   391 SLI--------VPEY----------QLGTAYGFCQSVQNLGLAVVTIAAGIIVDSSGGSHFWLQV 437

  Fly   300 LLLELLQLILFA 311
            ..:..|.:.|.|
  Fly   438 FFMSFLLVSLLA 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 57/312 (18%)
MFS_1 27..368 CDD:284993 57/312 (18%)
CG12194NP_001162873.1 MFS 61..454 CDD:119392 65/337 (19%)
MFS_1 64..416 CDD:284993 58/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.