DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and CG15890

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001285245.1 Gene:CG15890 / 32401 FlyBaseID:FBgn0030576 Length:599 Species:Drosophila melanogaster


Alignment Length:373 Identity:80/373 - (21%)
Similarity:158/373 - (42%) Gaps:79/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PLIGALSDIYGRKVLLLITVIFTSLPIPMMTMDNWWFFVISSISG-----VLGVSFSVAFAYVAD 136
            |::|....:.|    |::.|.|...|:....:..   .:..|:||     ::||     |:|:||
  Fly   171 PVVGEFLGVVG----LMLCVYFEQAPMEAAALTE---AIFPSLSGGWFTMLMGV-----FSYIAD 223

  Fly   137 VTTKEERSRSYELVSATFAASLVIAPAMGNLIMDRYGINTV--VLVATLVSTTNVMFVLLAVPET 199
            :||:|:|:....:::..|:..:.|..|...:::.:.|...|  :..|..|......|..|..|::
  Fly   224 ITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFLEEPQS 288

  Fly   200 LQQN-----------------VRSTGLSWKQADPFLSLRRVGSDPNVLLLCVVMFTFLLPEAGEY 247
            ..:.                 |::..:::|:.:   :.||    ..|:||.:|:...:.|..||.
  Fly   289 RPEKSAEQKSLLADFFDKEHVVQTFRVAFKKGE---NQRR----KRVILLMIVVMVIIGPLHGEM 346

  Fly   248 SSVPAYLKLTMGFDFTEL-----STLVAFMAILGISINVTLGSIVKTLGAKNAI--ILGLLLELL 305
            :  ..||.....|:::|:     ||...|..::|:...|  |.:...|...:|:  :|....::|
  Fly   347 A--VTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCV--GILSHKLNIDDALVGVLSSTSKIL 407

  Fly   306 QLILFAIGYEKWQMWLAGNVAALSSITFPAVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPAL 370
            ...::|.....|.|:|.|.|...:...|.|:.   |:.|.:.::..: |.:..:.|:...|.|.:
  Fly   408 SSFVYAFATLPWHMYLGGLVEIFNGTAFIAMR---SIATKLVSKDEL-GKVNSLFGVAEALMPMV 468

  Fly   371 FGIVF---YLSDMDLDKNRILIGSVSGDRTVTNPFMIGA----ISVFI 411
            |..::   |.:.:     |:|.|:.         |::|.    .||||
  Fly   469 FAPMYTTLYAATL-----RVLPGAF---------FLLGGGLTLFSVFI 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 70/328 (21%)
MFS_1 27..368 CDD:284993 68/321 (21%)
CG15890NP_001285245.1 MFS 135..507 CDD:119392 80/373 (21%)
MFS_1 135..470 CDD:284993 69/325 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.