DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and CG31321

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster


Alignment Length:436 Identity:95/436 - (21%)
Similarity:157/436 - (36%) Gaps:116/436 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IATLKETFPDHTFLMNGLVMGVKGILSFLSSPLIGALSDIYGRKVLLLITVIFTSLPIPMMTMDN 110
            |||.:|   |..|......|.|.|: .|:..|:.|               |:||       |:..
  Fly   223 IATPEE---DRVFRFGIFAMFVTGV-PFIGQPISG---------------VLFT-------TLGY 261

  Fly   111 WWFFVISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVIAPAMGNLIMDRYGIN 175
            .|.|..:.:..::.:.:.:.|  :.:|.|          ...|...:....|...:|...:.|.:
  Fly   262 TWSFASAIVFQLIAIFYIIFF--IKEVKT----------TPTTSTTANEPPPLPTSLPPKQQGAD 314

  Fly   176 TVVLVAT----LVSTTNVMFVLLAVPETLQQNVRSTGLSWKQA-DPFLSLRRVG----SDPN--- 228
            .:....|    |....||.|.|....|...:.|.......|:. ||.|.|..:.    ..||   
  Fly   315 NMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGR 379

  Fly   229 ---VLLLCVVMFTFLLPEAGEYSSVPAYLKLTM------GFDFTELSTLVAFMAILGISINVTLG 284
               :||||....| :.|.:||..   .:.:.|:      |.||:...||.:..|::|..|...: 
  Fly   380 MLLILLLCAYFLT-VGPTSGEND---YWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAI- 439

  Fly   285 SIVKTLGAKNAII--LGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITFPAVSAYVSL-YTDV 346
             :.|.|...:::|  |..|..:...:|||........::||           .|..:||| ...:
  Fly   440 -LSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAG-----------VVDMFVSLRVIAI 492

  Fly   347 ETQGAVQGMITG--------MSGLCSGLGPALFGIVF---YLSDMDLDKNRI-LIGSVSGDRTVT 399
            :|.|:  .::.|        :.|:...:...:|..:|   |.|.:|.....| |.|.:       
  Fly   493 KTIGS--SIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEI------- 548

  Fly   400 NPFMIGAISVFI--GILLASYIPDEKVSRGRREEFSALKYIIEMEE 443
              |.|..:.||:  ..||            ||.:.:..|.::|||:
  Fly   549 --FYIPNVLVFVVCYFLL------------RRRKANEEKSVVEMEQ 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 76/360 (21%)
MFS_1 27..368 CDD:284993 75/353 (21%)
CG31321NP_731899.1 MFS 141..>271 CDD:119392 18/73 (25%)
MFS_1 143..>271 CDD:284993 18/73 (25%)
MFS <379..559 CDD:119392 47/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.