DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and Slc46a1

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001013991.1 Gene:Slc46a1 / 303333 RGDID:1309472 Length:459 Species:Rattus norvegicus


Alignment Length:417 Identity:90/417 - (21%)
Similarity:159/417 - (38%) Gaps:90/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ETFPDH-TFLMN--GLVMGVKGILSFLSSPLIGALSDIYGRKVLLL-------------ITVIFT 99
            ||...| |..||  |.::|:      ..|.|:||.||..||:.||:             |.|:..
  Rat    79 ETLTSHWTLYMNVGGFLVGL------FWSTLLGAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQL 137

  Fly   100 SLPIPMMTMDNWWFFVISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVIAPAM 164
            .|.|....:......::...:|:|..|    ||.||||::...|:....|:.|....:..:|..:
  Rat   138 QLHIGFFVLGRALCALLGDFNGLLAAS----FASVADVSSNHSRTFRMALLEACIGVAGTLASLL 198

  Fly   165 GNLIMDRYGINTVVLVATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQADPFLSLRRVGSDPNV 229
            |...:...|......:|..|.....::......||::: .:||.|        .:||...|    
  Rat   199 GGHWLRAQGYANPFWLALAVLIVMTLYAAFCFGETVKE-PKSTRL--------FTLRHHRS---- 250

  Fly   230 LLLCVVMFTFLLPEAGEYS----SVPAYLKLTMGF------DFTELSTLVAFMAILGISINVTLG 284
               .|.::....||.....    |:..::.:|:.|      ...||||.:.:.:.|     :..|
  Rat   251 ---IVQLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYELSTPLCWDSKL-----IGYG 307

  Fly   285 SIVKTLGAKNAII----------------LGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITF 333
            |..:.|....:::                :||...:|.:::||.......|:....:..||.:|.
  Rat   308 SAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTT 372

  Fly   334 PAVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPALFGIVFYLSDMDLDKNRILIGSVSGDRTV 398
            |.:.|.:|.......|||:...:..::.|...:...:|..: |.:.::..|.             
  Rat   373 PVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSL-YPATLNFMKG------------- 423

  Fly   399 TNPFMIGAISVFIGILLASYIPDEKVS 425
             .||::||..:||..:|...:  |||:
  Rat   424 -FPFLLGAGLLFIPAILIGVL--EKVN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 78/365 (21%)
MFS_1 27..368 CDD:284993 77/358 (22%)
Slc46a1NP_001013991.1 MFS 22..444 CDD:421695 87/412 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.