DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and Slc46a3

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001020139.1 Gene:Slc46a3 / 288454 RGDID:1307594 Length:461 Species:Rattus norvegicus


Alignment Length:371 Identity:70/371 - (18%)
Similarity:128/371 - (34%) Gaps:111/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MNGLVMGVKGILSFLSSPLIGALSDIYGRKV-------------LLLITVIFTSLPIPMMTMDNW 111
            ::||:.|:......|||      ||.:|||:             |.|..:.:..||:.::....:
  Rat    78 ISGLIPGLVSTFMLLSS------SDNHGRKLPMVLSSLGSLGTNLWLCAMSYFDLPLQLLVASTF 136

  Fly   112 WFFVISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLV--IAPAMGNLIMDRYGI 174
                |.::.|.....:...|||:.| ..||.:.|...:....|...:|  :........:...|.
  Rat   137 ----IGALFGNYTTFWGACFAYIVD-QEKEYKHRIIRIAVLDFMLGVVTGLTGLSSGYFIRELGF 196

  Fly   175 NTVVLVATLVSTTNVMFVLLAVPETLQQN---VRSTGLSWKQADPF---LSLRRVGSDPNVLLLC 233
            .....:..:|...|:.::|..:.:.::::   :.:...|....|.|   ..|.:.||.....|||
  Rat   197 AWSYFIIAVVVLVNLAYILFFLSDPIKESSSQIVTMSCSESLKDLFYRTYMLFKNGSCKRRSLLC 261

  Fly   234 VVMFTFLLPEAGEYSSVPAYLKLTMGFDFTELSTLVAFMAILGISINVTLGSIVKTLGAKNAIIL 298
            :::||.                            :|.|..:.||:...||               
  Rat   262 LLIFTL----------------------------VVYFFVVFGITPVFTL--------------- 283

  Fly   299 GLLLELLQLILFAIGYEK-----WQMWLAGNVAALSSITFPAVSAYVSLY------TDVETQGAV 352
                           ||.     |.....|..:||.|::|  :|:::.::      .|:..  |.
  Rat   284 ---------------YELGPPLCWNEVYIGYGSALGSLSF--LSSFLGIWLFSYCLKDIHI--AY 329

  Fly   353 QGMITGMSGLC------SGLGPALFGIVFYLSDMDLDKNRILIGSV 392
            .|:.|.|.|:.      :.|...|..|.|:.:.|.|...|.::..|
  Rat   330 VGIFTTMVGMMLTAFTRTTLMMFLVRISFFFTIMPLSILRSMLSKV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 65/352 (18%)
MFS_1 27..368 CDD:284993 63/345 (18%)
Slc46a3NP_001020139.1 MFS 3..437 CDD:421695 70/371 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.