DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and CG30344

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_724759.1 Gene:CG30344 / 246552 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster


Alignment Length:370 Identity:82/370 - (22%)
Similarity:156/370 - (42%) Gaps:57/370 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IATLKETFPDHTFLMNGLVMGVKGILSFLSSPLIGALSDIYGRKVLLLITVIFTS--------LP 102
            :..:.:|:..:..:...|   ::.|:...:|..:|..||.:||:.:||.|  ||.        :.
  Fly   108 VEVIVQTYSANIMMTTSL---LESIIPAFASLFLGPWSDKFGRRPILLTT--FTGYLTGALILIV 167

  Fly   103 IPMMT----MDNWWFF---VISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVI 160
            |..:|    :..|||.   |.|.:||......:..:.|::||..:.:::....|..|:..|.:::
  Fly   168 ITYITRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIMV 232

  Fly   161 APAMGNLIMDRYGINTVVL--VATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQADPF------ 217
            .......|.  ...|.:||  :|..:....:|:|||.|||:|......||...::...|      
  Fly   233 GNVASGYIY--AATNALVLFSIAGSLMMFALMYVLLFVPESLNPGDIHTGSRVREFFRFDLVTDL 295

  Fly   218 ---LSLRRVGSDPNVLLLCVVMFTFLLPEAGEYSSVPAYLKLTMGFDFT--ELSTLVAFMAILGI 277
               ...||...|..::.|.::..|..:.:. |..|...|:.:...|::|  :.|...|...::.|
  Fly   296 IRTCFKRRPNFDRTIIWLTMIALTIAIFDM-EGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQI 359

  Fly   278 SINVTLGSIVKTLGAKNAI--------ILGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITFP 334
                 :||||..|..:..:        :|.|...:|:..:.|......:::|...:..:..:..|
  Fly   360 -----VGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLGMTLGMMRGVMGP 419

  Fly   335 ---AVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPA-LFGIVF 375
               |:.::|:..|:|   |.:..:.|.|..: |.||.| |:..|:
  Fly   420 MCRAILSHVAPATEV---GKIFALTTSMESV-SPLGAAPLYTTVY 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 81/368 (22%)
MFS_1 27..368 CDD:284993 78/360 (22%)
CG30344NP_724759.1 MFS 113..490 CDD:119392 82/365 (22%)
MFS_1 128..448 CDD:284993 74/333 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.