DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and si:ch211-262i1.4

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_021328126.1 Gene:si:ch211-262i1.4 / 101884492 ZFINID:ZDB-GENE-140106-10 Length:351 Species:Danio rerio


Alignment Length:344 Identity:76/344 - (22%)
Similarity:143/344 - (41%) Gaps:71/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LMNGLVMGVKGILSFLSSPLIGALSDIYGRKVLL-------------LITVIFTSLPIPMMTMDN 110
            |:..::..|..:||.:  || ..::|.:|.||.|             |:..::..:|:..:.:.:
Zfish    54 LIQSVLSSVMAMLSII--PL-SRMADHHGPKVFLVSSQMGSVLGMFTLVIFMYCEVPLEFLYLGS 115

  Fly   111 WWFFVISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVIAPAMGNLI---MDRY 172
                ::..:||. |..|....|.:|.::: |:|.|:.:|....|...  ||..:|.|:   :.:.
Zfish   116 ----LLHGLSGG-GPMFWAGVAALASLSS-EQRKRTLKLNIVDFCFG--IAGVVGGLLSGYLYQV 172

  Fly   173 GINTVVLVATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQADPFLSLRRVGSDPNVLLLCVVMF 237
            |.:.::|.|.|::|..:::.:.|:.:        :.||:.:.       .||:: |||.|     
Zfish   173 GPSVLLLTAILITTVALLYSVFALSD--------SRLSYSEG-------MVGAE-NVLQL----- 216

  Fly   238 TFLLPEAGEYSSVPAYLKLTMGFDFTELSTLVAFMAILGISINVTLGSIVKTLGAKNAIILGLLL 302
             |:|.....:.||.|    ..|...|....|.:|:|:|         |:...:|.....:||::.
Zfish   217 -FVLKPPLSWDSVWA----GYGRAATSAMYLSSFLAVL---------SLFNVMGDTALTLLGIVS 267

  Fly   303 ELLQLILFAIGYEKWQMWLAGNVAALSSITFPAVSAYVSLYTDVETQGAVQGMITGMSGLCSGLG 367
            ....:.:.|...|.| ::..|.|..|..:    :.|...|.::|.........:...||.|..|.
Zfish   268 NCTGMAIMAFTMESW-IYFLGRVFGLLQL----LLAVTDLLSNVCFTSIYPLTLRWFSGFCFILS 327

  Fly   368 PALFGI----VFYLSDMDL 382
            .|:..|    :.|||...|
Zfish   328 CAISYISAVPIIYLSGRTL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 72/335 (21%)
MFS_1 27..368 CDD:284993 70/324 (22%)
si:ch211-262i1.4XP_021328126.1 MFS_1 57..342 CDD:331686 72/335 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.