DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and mfsd10

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_004911324.2 Gene:mfsd10 / 100145046 XenbaseID:XB-GENE-958779 Length:454 Species:Xenopus tropicalis


Alignment Length:434 Identity:95/434 - (21%)
Similarity:172/434 - (39%) Gaps:92/434 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPSVGH--------ILVVVFLEYFAWGLLTMPMIATLKETFPD---------------------- 55
            :|:..|        :.|.:.::...:.|: :|::.::.|.|..                      
 Frog    10 QPTANHGSSRVISVVFVTLLIDLLGFTLI-LPLLPSILEHFSKSDDSLYQTIQHSVDWFASAIGV 73

  Fly    56 ------HTFLMNGLVMGVKGILSFLSSPLIGALSDIYGRKVLLLITVIFTSLPIPMMTMD-NWWF 113
                  ::.|..|.:..:..:|.|:.|||.||.||..||:..::||.:.......:..:. ::..
 Frog    74 PQERKYNSVLFGGFIGTIFSLLQFICSPLTGAASDYLGRRRAMMITAVGLIFSYTLWAISRSFGI 138

  Fly   114 FVISSISGVLGV-SFSVAFAYVADVTTKEERSRSYELVSATFAASLVIAPAMG-----NLIMDRY 172
            |::|.:.|.|.. :.|:..|.:||:...:.||....::...|:....|.|.:|     |...:..
 Frog   139 FILSRVVGGLSKGNVSLCTAIIADLPLLKNRSTGMAMIGVAFSLGFTIGPMIGAYFAMNAASEEI 203

  Fly   173 GINTVVLVATLVSTTNVMFVLLAVPETL--QQNVRSTGLSWKQADPFLS----------LRRVGS 225
            ......|:|...:..:::|:.|.:||||  :..|.|....:|.|...||          .||.||
 Frog   204 FYVRPALLALFFAVADLIFIFLFLPETLPKENRVPSVTAGFKGASDLLSPVALFHFSAITRRKGS 268

  Fly   226 D-----PNVLLLCVVMFTFLLPEAGEYSSVPAYLKLTMG------FDFTELSTLVAFMAILGISI 279
            .     ..:.||.:|.|.:|...:|        |:.|:.      |.|..:.....|. .:|:::
 Frog   269 PSPENVEKLRLLGMVYFLYLFLFSG--------LEYTLSFLTHQRFQFNSMQQGKMFF-FIGLTM 324

  Fly   280 NVTLGSIVKTL-------GAKNAIILGLLLELLQLILFAIGYEKWQMWLAGNVAALS---SITFP 334
            .|..|...:.:       ..|.||||.:...||      ||:....:.|...:...|   :|..|
 Frog   325 AVIQGGYARRIRPGNEIKAVKRAIILLIPAFLL------IGWATNLLVLGAGLLLYSFAAAIVVP 383

  Fly   335 AVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPALFGIVFYLS 378
            .:|:.||.|.....:|.|.|::..:..|...|||.|...:::|:
 Frog   384 CLSSLVSTYGSASQKGTVMGILRSLGALARALGPILSASLYWLA 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 92/415 (22%)
MFS_1 27..368 CDD:284993 89/408 (22%)
mfsd10XP_004911324.2 MFS_MFSD10 21..451 CDD:340947 93/423 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.