DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5078 and zgc:174356

DIOPT Version :9

Sequence 1:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001315535.1 Gene:zgc:174356 / 100137120 ZFINID:ZDB-GENE-080215-21 Length:464 Species:Danio rerio


Alignment Length:471 Identity:95/471 - (20%)
Similarity:189/471 - (40%) Gaps:114/471 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVFLEYFAWGLLTMP----MIAT------LKE----TFPDH-------TFLMNGLVMGVKGILSF 73
            |:|| |.:...:..|    ||.|      ||.    :.|:|       ....:.:.:....|||.
Zfish    17 VIFL-YMSSSFIVTPAIQQMIITKVCQDVLKNVSICSDPEHHKEYEHVQTTSSYIFLQFNAILSL 80

  Fly    74 LSSP---LIGALSDIYGRKVLL----LITVIFTSLPIPMMTMDN---WWFFVISSISGVLGVSFS 128
            :|.|   ::|:.||..||:.::    :::::...|.:.:..:||   :|..:.:::.|:.|...|
Zfish    81 VSIPPAIMLGSWSDSAGRRSVMALPSVLSLLSGGLLLAVSLLDNISVYWTLMAAALMGLTGGHVS 145

  Fly   129 V---AFAYVADVTTKEERSRSYELVSATFAASLV-----IAPAMGNLIMDRYGINTV-------- 177
            :   :|:|:||:|.....:|:..:   ..|.|::     |...:|..:...:|:...        
Zfish   146 IFLSSFSYLADLTMGSSSTRTLRM---AVAESMIFVGGTIGFLLGGFLEQEFGLQAAFGAYIGCH 207

  Fly   178 VLVATLVSTTNVMFVLLAVPE-TLQQNVR------STGLSWKQAD------------PFLSL--R 221
            |||        :::::|.:.: ::.:|.|      .|..|..|.|            .|.::  |
Zfish   208 VLV--------LLYIVLWLRDPSVGKNTRLVLCKEETAESGSQEDQSRLFILKYAKMSFKAVFKR 264

  Fly   222 RVGSDP---NVLLLCVVMFTFL--LPEAGEYSSVPAYLKLTMGFDFTELSTLV------AFMAIL 275
            |.|.:.   :.|:||    ||:  |...||.|.:..||.    ::..|.:|.:      ..|.:|
Zfish   265 RSGQERMKLHFLMLC----TFINNLVAVGEQSILLLYLM----YEPREFTTALFGVFNSVKMLLL 321

  Fly   276 GISINVTLGSIVKTLGAKNAIILGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITFPAVSAYV 340
            |..:......:::.:.......|..:..:...||.|:....|.::|...|.|.|.|:...:.:..
Zfish   322 GFGLLGLFPLLMRCVKEMTLAKLSAVFRIASYILLALSNNTWMVFLVAVVGAPSGISQAVIRSLS 386

  Fly   341 SLYTDVETQGAVQGMITGMSGLCSGLGPALFGIVFYLSDMDLDKNRILIGSVSGDRTVTNPFMIG 405
            |.....:.|||:......:...|..:...:|..::.|:          :.:..|     .||:|.
Zfish   387 SAIVGPDEQGAMFSFSASVEATCILIAATIFNGLYPLT----------LPTFPG-----MPFIIM 436

  Fly   406 AISVFIGILLASYIPD 421
            |..:.|.::|..:|.:
Zfish   437 AAFMLIVLILLQWISE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5078NP_649238.3 MFS 27..375 CDD:119392 86/423 (20%)
MFS_1 27..368 CDD:284993 85/416 (20%)
zgc:174356NP_001315535.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.