DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and SIT1

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_010849.3 Gene:SIT1 / 856644 SGDID:S000000791 Length:628 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:64/299 - (21%)
Similarity:111/299 - (37%) Gaps:95/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLKFLR-PLVK-VLVNRSGIGKASVWHAVIVTFMHYFSWGLLTVPFIEKLSGSFGNRVLLV---D 62
            ::|:.| ||.. .|:...||     :.|:::.|...|:|         .:.|.:...||:|   :
Yeast   336 EIKYSRHPLTPWDLIQDRGI-----FFALLIAFFINFNW---------YMQGDYMYTVLVVAVHE 386

  Fly    63 GLVYGVR--GILGFVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMMLK-SWWF--FAILT--- 119
            .:....|  .:..||:. ::|.|..|      :|:.|..|.   ||::.. |.|.  |.:|.   
Yeast   387 SIKSATRITSLYSFVSV-IVGTILGF------ILIKVRRTK---PFIIFGISCWIVSFGLLVHYR 441

  Fly   120 ---------VSSIC------GS-TYSSSLAYVADTTTVENRSKGYGFVAASFGAGIAFSPSLG-- 166
                     :.|:|      || ||.:..:..|...|....:.......|::..|.||..|:.  
Yeast   442 GDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIGSAFGSSVSGA 506

  Fly   167 ---NYLMK--------------SYGS----------------ASVILIATITGMINILFIIFAVP 198
               |.|.|              :|||                |.|:....:..::.|:.::|..|
Yeast   507 VWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFP 571

  Fly   199 E---SLVLKEKKV---ILNENNDNKVEDTKVDDISPKEK 231
            .   :.:|:..|:   |..|.||: :|.....:|..||:
Yeast   572 LLGCAFMLRNHKLTDSIALEGNDH-LESKNTFEIEEKEE 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 57/275 (21%)
MFS_1 30..441 CDD:284993 56/270 (21%)
SIT1NP_010849.3 MFS_ARN_like 70..582 CDD:340880 55/269 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.