DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and ARN2

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_011816.2 Gene:ARN2 / 856338 SGDID:S000001039 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:45/234 - (19%)
Similarity:86/234 - (36%) Gaps:69/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 VPESLVLKEKKVILNENNDNK--VEDTKVDDISPK-EKKENLNGEGKVNVEVNKPTSQNIVTNKE 258
            |||.....:.|....|.|.|:  |::...||.||: |.|:.|.|           |...|:...|
Yeast     4 VPEDNRSSQTKRKNTEKNCNELMVDEKMDDDSSPRDEMKDKLKG-----------TKSLIIRKSE 57

  Fly   259 LDQQFSKEENLQNDLTEKEKIDNGSLNSSDLWEVLRKSRKDKNLLVIYLIT-FLSIWPFAGVDST 322
            |             :.:|          .|.|:          |..|:|.: |:..:.: |:||:
Yeast    58 L-------------MAKK----------YDTWQ----------LKAIFLFSAFICTFAY-GLDSS 88

  Fly   323 APVYLKT---NMGFEYEEVSMMLGLLSVLAITSNILLGYIMNIVGAKWSIRLGLLLLFLQMLFFG 384
            ......|   |....:..:|.:..::.:::..|.::.|.:.:|.|     ||.|.|:.:.:...|
Yeast    89 IRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSDIFG-----RLTLFLVSIVLYIVG 148

  Fly   385 ------------FGTHHWMYWLSSILAALATIIPAANNA 411
                        :......|::..:...|..::..::|:
Yeast   149 TIIQSQAYDVQRYAAGAVFYYVGLVGVMLQVVLMLSDNS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 45/234 (19%)
MFS_1 30..441 CDD:284993 45/234 (19%)
ARN2NP_011816.2 MFS_ARN_like 69..581 CDD:340880 21/125 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.