DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and AZR1

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_011740.3 Gene:AZR1 / 853139 SGDID:S000003456 Length:613 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:48/262 - (18%)
Similarity:93/262 - (35%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 NLNGEGKVNVEVNKPTSQNIVTNKELDQQFSKEE---NLQNDLTEKEKIDNGSLNSSDLWEVLRK 295
            :|:..|:...:.|:...:..|..:...|..||:.   .|:::.:|..::..|.:..:        
Yeast    12 DLSYYGEKAQQQNEKQQKQYVVRRNSTQSTSKQNVSVVLEDNASESNELPKGFILYA-------- 68

  Fly   296 SRKDKNLLVIYLITFLSIWPFAGVD----STAPVYLKTNMGFEYEEVSMMLGLLSVLAITSNILL 356
                 :|:.:.|..||     |.:|    ||....:....| .|.|:..:....|:    .|.||
Yeast    69 -----SLIALALSLFL-----AALDIMIVSTIIEEVAKQFG-SYSEIGWLFTGYSL----PNALL 118

  Fly   357 GYIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATI----------------- 404
            ..|       |. |:...:.|.:.:.|..    .::.:.|:::|||..                 
Yeast   119 ALI-------WG-RIATPIGFKETMLFAI----VIFEIGSLISALANSMSMLIGGRVIAGVGGCG 171

  Fly   405 IPAANNAVASIYASPDNRGAVLGIISGIECLSEGVGP--------------AFF------GLLFF 449
            |.:.:..:.|.......||.::.::|....::..|||              .|:      ||.||
Yeast   172 IQSLSFVIGSTLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSVTWRWCFYVNLPIGGLAFF 236

  Fly   450 IF 451
            :|
Yeast   237 LF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 48/262 (18%)
MFS_1 30..441 CDD:284993 40/230 (17%)
AZR1NP_011740.3 MFS_Azr1_MDR_like 83..540 CDD:341045 33/173 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.