DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and GEX1

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_009863.2 Gene:GEX1 / 850289 SGDID:S000000575 Length:615 Species:Saccharomyces cerevisiae


Alignment Length:323 Identity:68/323 - (21%)
Similarity:121/323 - (37%) Gaps:101/323 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLKFLR-PLV--KVLVNRSGIGKASVWHAVIVTFMHYFS--------WGLLTV------------ 44
            :.||.: ||:  |:|.:|      .:|..:.|||.::|:        :.:|.|            
Yeast   326 EAKFAKSPLLPFKLLSDR------GIWAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARI 384

  Fly    45 ------------PFIE---------KLSGSFGNRVLLV-DGLVYGVRGILG-----FVTTPVMGA 82
                        ||..         |||...|....:| .||.|..||..|     ...:.:||.
Yeast   385 VNLPDFVAATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL 449

  Fly    83 ISDFHGRKVVMLLAVATTYAPIPFMMLKSWWFFAILT----VSSICGSTYSSSLAYVADTTTVEN 143
            ........|:::|...||::.:           |::|    ..|..|:...:|::....|.|:.|
Yeast   450 SGLLCSNSVIVILQAMTTHSRM-----------AVITGIQYTFSKLGAAIGASVSGAIWTQTMPN 503

  Fly   144 RSKGYGFVAASFGAGIAF-SP--SLGNY---------LMKSYGSASVILIATITGMINILFIIFA 196
            :.  |..:.....|.||: ||  .:.:|         :::||.....| |.|:.....:.|..| 
Yeast   504 QL--YKNLGNDTLAEIAYASPYTFISDYPWGSPERDAVVESYRYVQRI-IMTVGLACTVPFFAF- 564

  Fly   197 VPESLVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVEVNKPTSQNIVTNKEL 259
               ::.:::.::|....::...||..|  :.|.|  ||:..:.|.....|:       :||:|
Yeast   565 ---TMFMRDPELIDKATHEEFTEDGLV--VLPDE--ENIFSQIKALFRHNR-------SNKKL 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 61/298 (20%)
MFS_1 30..441 CDD:284993 60/293 (20%)
GEX1NP_009863.2 MFS_ARN_like 59..571 CDD:340880 55/268 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.