DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17637 and SLC46A2

DIOPT Version :9

Sequence 1:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_149040.3 Gene:SLC46A2 / 57864 HGNCID:16055 Length:475 Species:Homo sapiens


Alignment Length:468 Identity:80/468 - (17%)
Similarity:151/468 - (32%) Gaps:181/468 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LSGSFGNRVLLVDGLVYGVRGILGFVTTPVMGAISDFHGRKVVMLLAVATTYAPIPFMMLKSWWF 114
            |:|.||.......|::             .:|::....||:.|.|:.:.                
Human   142 LNGLFGGFSAFWSGVM-------------ALGSLGSSEGRRSVRLILID---------------- 177

  Fly   115 FAILTVSSICGSTYSSSLAYVADTTTVENRSKGYGFVAASFGAGIAFSPSLGNYLMKSYGSASVI 179
             .:|.::..|||..|..|               :..:|...|.|:..:..       |...||..
Human   178 -LMLGLAGFCGSMASGHL---------------FKQMAGHSGQGLILTAC-------SVSCASFA 219

  Fly   180 LIATITGMINILFIIFAVPESLVLKEKKVILNENNDNKVEDTKVDDISPKEKKENLNGEGKVNVE 244
            |:.::        ::..||||:....:::            ..||.:|           |.|.  
Human   220 LLYSL--------LVLKVPESVAKPSQEL------------PAVDTVS-----------GTVG-- 251

  Fly   245 VNKPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDNGSLNSSDLWEVLRKSRKDKNLLVIYLIT 309
                 :...:...:||||::.                |...|..      |::..|..:.:..:.
Human   252 -----TYRTLDPDQLDQQYAV----------------GHPPSPG------KAKPHKTTIALLFVG 289

  Fly   310 FLSIWPFA--GVDSTAPVY-LKTNMGFEYEEVS---------MMLGLLSVLAI------TSNILL 356
            .: |:..|  |.....|:: |:..:|:...:|.         .:...|.||..      |:.|::
Human   290 AI-IYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMI 353

  Fly   357 GYIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYASPDN 421
            |.:        |...|.|||       .|....:|::::..:...| :||     |.:|      
Human   354 GMV--------SFGSGALLL-------AFVKETYMFYIARAVMLFA-LIP-----VTTI------ 391

  Fly   422 RGAVLGIISGIECLSEGVGPAFFGLLFFIFQ-------------DDSETDLKVNSPISMPFVISA 473
            |.|:..:|.|          :.:|.:|.|.|             .:....|.::..:...|.:|:
Human   392 RSAMSKLIKG----------SSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVGSCFALSS 446

  Fly   474 ISVFVAIVLSSFI 486
            ...|:||:..|.:
Human   447 FLSFLAIIPISIV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17637NP_649237.1 MFS 25..487 CDD:119392 80/468 (17%)
MFS_1 30..441 CDD:284993 69/408 (17%)
SLC46A2NP_149040.3 MFS_1 84..421 CDD:284993 73/428 (17%)
MFS <282..453 CDD:304372 37/208 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5729
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.